SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940158|ref|YP_001645042.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940158|ref|YP_001645042.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.66e-19
Family Phage repressors 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940158|ref|YP_001645042.1|
Sequence length 72
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MAIIINIDVMLAKRKMSVTELSERVGITMANLSILKNGKAKAVRFSTLEAICKTLDCQPG
DILEYKSDEFTQ
Download sequence
Identical sequences A0A0A0WN59 A0A150BZI7 A0A243AB14 A9VF38 J8CFE0 J8EMK5 R8HMP9 R8QIH5
315730.BcerKBAB4_2194 gi|163940158|ref|YP_001645042.1| WP_002141696.1.10033 WP_002141696.1.100479 WP_002141696.1.100649 WP_002141696.1.17940 WP_002141696.1.28299 WP_002141696.1.30061 WP_002141696.1.4496 WP_002141696.1.47957 WP_002141696.1.54007 WP_002141696.1.57105 WP_002141696.1.64566 WP_002141696.1.73166 WP_002141696.1.85012 WP_002141696.1.86789 WP_002141696.1.93582 WP_002141696.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]