SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940218|ref|YP_001645102.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940218|ref|YP_001645102.1|
Domain Number 1 Region: 51-183
Classification Level Classification E-value
Superfamily RmlC-like cupins 7.52e-26
Family Probable transcriptional regulator VC1968, C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.07e-16
Family Probable transcriptional regulator VC1968, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163940218|ref|YP_001645102.1|
Sequence length 185
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MEEIQLILAKNIKAIREKEKLSLEKVSQLTGVSKTMIGQIERGDSSPTLTTIWKIANGLK
VSFTSLINNPQPDTKVVLRNDVQVLSEDNGRYKVYPSFPFQDDRNFEIYTVEIETEGKLS
SEGHKEGTEEFITVFEGELTIEINDCQYTLNSGDSIRFKADRPHSYHNSGRTLTRLSMTI
YYPAS
Download sequence
Identical sequences A0A1C3T9J3 A9VF98 C2PVZ3 J7X4B5 J8HG94 J8NP92
gi|163940218|ref|YP_001645102.1| 315730.BcerKBAB4_2254 WP_002012881.1.28299 WP_002012881.1.47957 WP_002012881.1.52845 WP_002012881.1.79293 WP_002012881.1.8290 WP_002012881.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]