SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940262|ref|YP_001645146.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940262|ref|YP_001645146.1|
Domain Number 1 Region: 13-183,399-482
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.86e-53
Family Bacterial dinuclear zinc exopeptidases 0.018
Further Details:      
 
Weak hits

Sequence:  gi|163940262|ref|YP_001645146.1|
Domain Number - Region: 213-302
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000297
Family Bacterial exopeptidase dimerisation domain 0.0098
Further Details:      
 
Domain Number - Region: 188-220
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 0.0249
Family Peptidyl-tRNA hydrolase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163940262|ref|YP_001645146.1|
Sequence length 489
Comment aminoacyl-histidine dipeptidase [Bacillus weihenstephanensis KBAB4]
Sequence
MYSTLEQLTKHPVFYHFAEISKIPRGSGNEKEISDYLVSFAKERNLEVIQDEALNVIIKK
EATSGYENVPAIIIQGHSDMVCEKNQATVHDFEKDPIELRIIGDMLYASETTLGADNGIA
VAYALALLDSTDIPHPALEVVITTEEETTMGGAFAVDSNHFDGKIFINIDSEEDHKLLVS
SAGGAKAVETISVIWDEASVDMDTYRLYVGGLKGGHSGLEIDKQRGNANKVLGRVLRDLS
LHIQFNMSEVHGGLKTNAIPRESVATILLRAEDVQQVEEKLKSWTRMLQEELRAVDPDVH
VSLTKVEEKAEKVFSKETQKQLISSLFLIPNGIQSMSMDIKGLVESSTNLGVIQTLQDEI
KLRSEVRSSVSSLKQHIVDEIKYIAELVGATFEKESEYPEWPYNPNSPIRNLFEKVHQEK
YSKDAEIFAVHAGIECSVFVQKMPELDAISFGPDIFNVHTPDEHISISSVVNNWGFFVDV
MQGTKELAK
Download sequence
Identical sequences A9VFX7 J8CDA1 R8D0W4
gi|163940262|ref|YP_001645146.1| WP_002141788.1.68668 WP_002141788.1.85012 WP_002141788.1.99908 315730.BcerKBAB4_2301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]