SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940297|ref|YP_001645181.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940297|ref|YP_001645181.1|
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.06e-44
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.016
Further Details:      
 
Domain Number 2 Region: 374-473
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.24e-30
Family Single-domain sulfurtransferase 0.044
Further Details:      
 
Domain Number 3 Region: 239-354
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000786
Family Single-domain sulfurtransferase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940297|ref|YP_001645181.1|
Sequence length 478
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPSRYIEQYIEFAKKEGMEVIAAAETHIHAD
FLSGSRELSLLFNANLYVSDEGDSDWKYQNLNEGRYNLVREGTEFKVGHIKFNVIHTPGH
TPESISFLVTDTSQNNYMNDKPIGIFTGDFIFVGDIGRPDLLEIAVGIKDTAKIGAKQLF
DSIQKIKIFPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFQCNDEDNFISNLL
TGQPEPPKYFPLMKHLNKYGPPTRKKREITAIYIIEELQEVMRGVQQIVDIRDVECFAAG
HIEKSINIPYNNSFTTWCGGILDYKKETLIILDAENVKVEEVIRDFESIGLDNIIAFAPS
KVIQRFHSLEIYKEKTSNELYPLIKDGSVKVIDVRSKKEWDEGHLHDAIHITLGNLLERL
DDVPKNCPIVLQCRTGLRSAIAASILQKADIKKVVNLKGGFLTWKKEGLPYTTCNQEI
Download sequence
Identical sequences A9VG12 J8CDC7 J8PLZ8
315730.BcerKBAB4_2338 WP_002141829.1.47674 WP_002141829.1.85012 WP_002141829.1.99908 gi|163940297|ref|YP_001645181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]