SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940408|ref|YP_001645292.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940408|ref|YP_001645292.1|
Domain Number 1 Region: 55-131,158-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.35e-38
Family Hypothetical protein TM0207 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163940408|ref|YP_001645292.1|
Sequence length 320
Comment outer membrane protein RomA [Bacillus weihenstephanensis KBAB4]
Sequence
MKKKYMNQIPTDVSFNPKDIIGLMTDYFKMKTKLRPIKDLPIVLPNKDNGSLESVTWFGH
SASLLEIEGKKLLLDPMFGDASSPFPVFNSKRYSGAFSLEREDFKEIDAIIISHNHYDHL
NYKSIMQLKDRAKHFYVPTGVAKYLIKWGISPSKISEHNWWDEITFDNIKLVCAPARHFS
GRSMTDRDCSLWCSWLILGQETKVFFSGDSGYAPHFKEIGEKYGPFDLTLMECGQYDTRW
SAIHMLPEETVQAHIDVKGELLVPIHWGAFTLALHEWSDPIERVTKEANRLGVNIATPQI
GEVIALQSKDYPTAAWWREV
Download sequence
Identical sequences A9VGV1 C2PWQ0 J8CUN4 J8I1B9
315730.BcerKBAB4_2454 gi|163940408|ref|YP_001645292.1| WP_002013235.1.28299 WP_002013235.1.79293 WP_002013235.1.85012 WP_002013235.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]