SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940542|ref|YP_001645426.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940542|ref|YP_001645426.1|
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.19e-44
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 126-204
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 1.44e-23
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163940542|ref|YP_001645426.1|
Sequence length 221
Comment ribose-5-phosphate isomerase A [Bacillus weihenstephanensis KBAB4]
Sequence
MMNLKQLAGEYAAGFVRDGMTIGLGTGSTVYWTIQKLGHRVQEGLSIQAVPTSKETEVLA
KQLSIPLISLNEIDILDLTIDGADEINNDLQLIKGGGGALLREKIVATSSKELIIIADES
KLVSHLGTFPLPIEIISFSWKQTEKRIQSLGCETHLRMKDSRPFITDNGNLIIDCIFPNK
ILNPNDTHTELKMITGVVETGLFINMKSKAIIGTKNGIKEY
Download sequence
Identical sequences A9VID8
315730.BcerKBAB4_2596 gi|163940542|ref|YP_001645426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]