SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940620|ref|YP_001645504.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940620|ref|YP_001645504.1|
Domain Number 1 Region: 144-339
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000797
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000591
Family Phage repressors 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163940620|ref|YP_001645504.1|
Sequence length 422
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MEIGERIRQVRMHKGLTQGELVSEICSITYLSRIESGKIKPSSSFLKQVSKKLGVDCDFL
IDGNYEEIKLTILEICNKYKKDKIITEAELSLLELYVREVDAIPLLLKTYGVIIYYHVRN
KNLLYVKLFVDQASQMILSQVEMQDTEDYIYYLRARGLYFSNKGEYFTAYEVYKKIENML
ELEETELHADTYYNLSIVSQNLNKDQSISRIYAKKAYKLYKKFNIEQYKIYALILLAMQY
NKDKQYEQAYETLKQVENESKVENEPLNLCFLKYNYGKIYQALKDYKNAIKCYKENLILC
EYLPNKEGKVYTIRNLIEIYIELKDWQTVTKLIDEAFEILSICDVPYAHVQLYGFKAEKS
KIWTDYNGYEKNMKTAIEMGIEKQQFSLVTELAYKLGDYYYENRSYKLSAKYFKISAENK
MD
Download sequence
Identical sequences A9VIL6
gi|163940620|ref|YP_001645504.1| 315730.BcerKBAB4_2675 WP_012261111.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]