SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940633|ref|YP_001645517.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163940633|ref|YP_001645517.1|
Domain Number - Region: 5-69
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.022
Family DNA-binding N-terminal domain of transcription activators 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163940633|ref|YP_001645517.1|
Sequence length 207
Comment hypothetical protein BcerKBAB4_2688 [Bacillus weihenstephanensis KBAB4]
Sequence
MITNLISKKDLLELTGISYGQLYRWKRKNLIPEDWFVRKSTFTGQETFFPKEKILERIDK
IQTMKEDLSLDELANMFSPSVTEILLAKEDLIRKEITSEPVLQFFMEQTNKTADFQFADI
LYVYVLEELLQSGDVSLEEGKMVLQVLRENYEAIKHKNCDLVIIRKLGISTCFLVSSVED
LIFEKGTKIVLRVAIMKYTEALKTKLL
Download sequence
Identical sequences A0A2B4Y070 A9VJ82 R8HV40
315730.BcerKBAB4_2688 WP_012261120.1.17940 WP_012261120.1.99908 gi|163940633|ref|YP_001645517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]