SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163940687|ref|YP_001645571.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940687|ref|YP_001645571.1|
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 78-185
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000473
Family Tetracyclin repressor-like, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163940687|ref|YP_001645571.1|
Sequence length 188
Comment TetR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MAKNKQEDIFDAAIKLFAERGYDGTTIPMIAEKANVGAGTIYRYFENKEALVNSLFSKSM
LQLSETIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFD
DFIGFFMNIIEDGIEKGFLRPLPIIALIIIVYQPLEKLIKVMATGQLEYSKELVKELEES
SWNAIRII
Download sequence
Identical sequences A0A0A0WNM0 A0A1I6C439 A0A1S9TVI9 A0A243A025 A9VJD6 C2PX39 J8I842 J8IMH9 J8KQ40 J8PNC3 J9CHH5 R8D3U3 R8DAB4 R8ETT7 R8HWH3 R8N126 W4ERP4
WP_002013443.1.100646 WP_002013443.1.100649 WP_002013443.1.11324 WP_002013443.1.17940 WP_002013443.1.20051 WP_002013443.1.20881 WP_002013443.1.21695 WP_002013443.1.27729 WP_002013443.1.28299 WP_002013443.1.2902 WP_002013443.1.30061 WP_002013443.1.36226 WP_002013443.1.37635 WP_002013443.1.37801 WP_002013443.1.38645 WP_002013443.1.39317 WP_002013443.1.39896 WP_002013443.1.4354 WP_002013443.1.45835 WP_002013443.1.46157 WP_002013443.1.47674 WP_002013443.1.47957 WP_002013443.1.50411 WP_002013443.1.57105 WP_002013443.1.60236 WP_002013443.1.63476 WP_002013443.1.6426 WP_002013443.1.64566 WP_002013443.1.68186 WP_002013443.1.68668 WP_002013443.1.72867 WP_002013443.1.76817 WP_002013443.1.79293 WP_002013443.1.82832 WP_002013443.1.85187 WP_002013443.1.86789 WP_002013443.1.87416 WP_002013443.1.93582 WP_002013443.1.99558 WP_002013443.1.99908 gi|163940687|ref|YP_001645571.1| 315730.BcerKBAB4_2743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]