SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940744|ref|YP_001645628.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940744|ref|YP_001645628.1|
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.63e-19
Family Phage repressors 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163940744|ref|YP_001645628.1|
Sequence length 75
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MAIIINIDVMLAKRKMSVTELSEKVGITMANLSILKNGKAKAIRITTLDAICKALECQPG
DLLEYKPEISDVDHE
Download sequence
Identical sequences A9VK45 J8CRL0
gi|163940744|ref|YP_001645628.1| 315730.BcerKBAB4_2804 WP_002142286.1.85012 WP_002142286.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]