SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940759|ref|YP_001645643.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940759|ref|YP_001645643.1|
Domain Number 1 Region: 28-456
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.49e-153
Family Heme-dependent catalases 0.000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940759|ref|YP_001645643.1|
Sequence length 459
Comment catalase [Bacillus weihenstephanensis KBAB4]
Sequence
MDENYDKQGQSLLGKGFNENGERNEQAKLHSQTVGSRGPILKQDNVLHEALQEFIHEKIL
ERPVHAKGFGAFGYFQTIYPMSEHTKLSFLQNSNEKVPVMVRFSLAVSTKGTPDTSRNVR
GFATKFYTKEGVFDLLCNHLPVFSVRDPMRFPETINALLPSPKNNLIDPDRFWDFVARAP
ESIHFVVRLYSDAGTVKSLRHIPGHSVNTYVWRNAQGYRKYVKYHWYPFEGVQFITSEEA
NKLAAENPDYSGKDLYDTIEAGKAVEYGLYVQLMDPKDETHLSYDPLDDTKVWDEKEYPL
IPVGKMILNKNPENYKEQVEKVAFSPSNLLDGAELSDDKMLQGRANIYSDSQRRRIGPEF
RKIAINQQQNWTPANQATSGDGRYVEGKLERTSITKQDDFVQPGEFYEKLTQIEKEHLAE
NLASDLNVISDDIRKIVLGYFDQVSTDLKTSIGTKMKEH
Download sequence
Identical sequences A9VK60
WP_012261184.1.99908 315730.BcerKBAB4_2820 gi|163940759|ref|YP_001645643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]