SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940975|ref|YP_001645859.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940975|ref|YP_001645859.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.51e-17
Family Phage repressors 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163940975|ref|YP_001645859.1|
Sequence length 242
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MREIHIHKIIADKRKEKGITQEELAAYIGITKASVSKWETGQSYPDITFVPLLASYFNIS
IDELICYTLQMEQEDIKNLYHRLAEAFSEEPFDEVMMECREVTKKYYSCFPLLIQMGLLF
INHHMLTEDMDRRIEILEEAMYLFSRVQGESVDVSLVKEAVSFKATCYLILNRPNEVLQL
LGETIRPNFPEEDLIAQAYQMFGNAEKANEMMQISMYQHLIQLVATIPNYVVVHASNAEK
VE
Download sequence
Identical sequences A9VLW5
gi|163940975|ref|YP_001645859.1| WP_012261285.1.99908 315730.BcerKBAB4_3051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]