SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941018|ref|YP_001645902.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941018|ref|YP_001645902.1|
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.76e-21
Family DNA-binding N-terminal domain of transcription activators 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941018|ref|YP_001645902.1|
Sequence length 134
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPL
CEIKEKIEEKKLLGINEHVSKQVNEVTDHIHRLEAELTELKPLLDELTDSQREKISKSLS
GQTTALIQTLALLL
Download sequence
Identical sequences A0A1S9T2P2 A0A243AH94 A9VM08
gi|163941018|ref|YP_001645902.1| 315730.BcerKBAB4_3096 WP_012261301.1.17940 WP_012261301.1.30061 WP_012261301.1.31050 WP_012261301.1.4496 WP_012261301.1.52845 WP_012261301.1.57105 WP_012261301.1.64566 WP_012261301.1.85012 WP_012261301.1.86789 WP_012261301.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]