SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941100|ref|YP_001645984.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941100|ref|YP_001645984.1|
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Hypothetical protein YojF 4.97e-54
Family Hypothetical protein YojF 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163941100|ref|YP_001645984.1|
Sequence length 116
Comment hypothetical protein BcerKBAB4_3180 [Bacillus weihenstephanensis KBAB4]
Sequence
MEIVKDSSLIQNEIERFVNKDVYIHLETTNGAYASHFNEKMMTVGAFIRNAIIRFERGKI
TGTNPYRVGLKMDHGWVYAEGITHWEVDDKERLLLAGHDNQGRLAVALELSLTPFK
Download sequence
Identical sequences A0A084J0J9 A0A0B5VYT2 A0A0E1MIV9 A0A0T8XPU4 A0A158RG77 A0A1A9PUM3 A0A1H4FV99 A0A1I6BW27 A0A1J9T1I3 A0A1J9UN32 A0A1J9W081 A0A1J9YDH2 A0A1J9ZBX4 A0A1J9ZC37 A0A1K0BJ51 A0A1V6L7T9 A0A1V9W8D9 A0A242WY01 A0A242X3S3 A0A242XFW0 A0A242YFB0 A0A242ZKE7 A0A243GPV4 A0A243IIB0 A0A243K103 A0A243MXB8 A0A246PMA8 A0A2A7E996 A0A2B4FAR0 A0A2B4NEC0 A0A2I0RCY7 A0RGN3 A9VMT3 B3ZIQ3 C2NKL6 C2PYM2 C2QW00 C2SMZ3 C2UY44 C2VEM8 C2XWR8 C2YUA4 C2ZAL9 C3C593 C3GLS5 J7WAR4 J7XME2 J8BCM2 J8CYD5 J8FGU8 J8I7J3 J8KIR0 J8MVC5 J8P049 J8PNT7 J8XMW1 J9AJ17 J9CBK4 K0FRN4 Q734C7 R8D7X8 R8EPN5 R8HJX9 R8HYN2 R8LPN4 R8MVE4 R8P0I9 W4EGB6
gi|407705853|ref|YP_006829438.1| gi|557620249|ref|YP_008781380.1| WP_000407039.1.100059 WP_000407039.1.100215 WP_000407039.1.10033 WP_000407039.1.100621 WP_000407039.1.100646 WP_000407039.1.100649 WP_000407039.1.100771 WP_000407039.1.101140 WP_000407039.1.101550 WP_000407039.1.11060 WP_000407039.1.11324 WP_000407039.1.11380 WP_000407039.1.11609 WP_000407039.1.12751 WP_000407039.1.13113 WP_000407039.1.13221 WP_000407039.1.13424 WP_000407039.1.14084 WP_000407039.1.15502 WP_000407039.1.16355 WP_000407039.1.17265 WP_000407039.1.17408 WP_000407039.1.17927 WP_000407039.1.17940 WP_000407039.1.1809 WP_000407039.1.1850 WP_000407039.1.1907 WP_000407039.1.19173 WP_000407039.1.195 WP_000407039.1.20051 WP_000407039.1.20643 WP_000407039.1.20881 WP_000407039.1.20973 WP_000407039.1.21643 WP_000407039.1.21695 WP_000407039.1.22507 WP_000407039.1.226 WP_000407039.1.22991 WP_000407039.1.23100 WP_000407039.1.23110 WP_000407039.1.23136 WP_000407039.1.23200 WP_000407039.1.23427 WP_000407039.1.23615 WP_000407039.1.23873 WP_000407039.1.2407 WP_000407039.1.24338 WP_000407039.1.24676 WP_000407039.1.24759 WP_000407039.1.24792 WP_000407039.1.24969 WP_000407039.1.24992 WP_000407039.1.2521 WP_000407039.1.25505 WP_000407039.1.25572 WP_000407039.1.2569 WP_000407039.1.25757 WP_000407039.1.26000 WP_000407039.1.26847 WP_000407039.1.27138 WP_000407039.1.27140 WP_000407039.1.27729 WP_000407039.1.27732 WP_000407039.1.28299 WP_000407039.1.28913 WP_000407039.1.2902 WP_000407039.1.2904 WP_000407039.1.29766 WP_000407039.1.30061 WP_000407039.1.30091 WP_000407039.1.30144 WP_000407039.1.3026 WP_000407039.1.30317 WP_000407039.1.30788 WP_000407039.1.31050 WP_000407039.1.3130 WP_000407039.1.31387 WP_000407039.1.31503 WP_000407039.1.3196 WP_000407039.1.33536 WP_000407039.1.33828 WP_000407039.1.35026 WP_000407039.1.35095 WP_000407039.1.35153 WP_000407039.1.3561 WP_000407039.1.3612 WP_000407039.1.36226 WP_000407039.1.3699 WP_000407039.1.37019 WP_000407039.1.37027 WP_000407039.1.37626 WP_000407039.1.37635 WP_000407039.1.37649 WP_000407039.1.37661 WP_000407039.1.37801 WP_000407039.1.38517 WP_000407039.1.38645 WP_000407039.1.39001 WP_000407039.1.39255 WP_000407039.1.39538 WP_000407039.1.39896 WP_000407039.1.4039 WP_000407039.1.40839 WP_000407039.1.41083 WP_000407039.1.42165 WP_000407039.1.42182 WP_000407039.1.42217 WP_000407039.1.42237 WP_000407039.1.42272 WP_000407039.1.42747 WP_000407039.1.42941 WP_000407039.1.4354 WP_000407039.1.44449 WP_000407039.1.44483 WP_000407039.1.4453 WP_000407039.1.4496 WP_000407039.1.45089 WP_000407039.1.46157 WP_000407039.1.46349 WP_000407039.1.46476 WP_000407039.1.4649 WP_000407039.1.46524 WP_000407039.1.46586 WP_000407039.1.47095 WP_000407039.1.473 WP_000407039.1.474 WP_000407039.1.47674 WP_000407039.1.47957 WP_000407039.1.49802 WP_000407039.1.499 WP_000407039.1.50350 WP_000407039.1.50411 WP_000407039.1.50416 WP_000407039.1.50487 WP_000407039.1.50770 WP_000407039.1.51099 WP_000407039.1.51167 WP_000407039.1.51335 WP_000407039.1.51656 WP_000407039.1.52494 WP_000407039.1.52532 WP_000407039.1.52845 WP_000407039.1.52932 WP_000407039.1.53621 WP_000407039.1.53672 WP_000407039.1.53916 WP_000407039.1.54007 WP_000407039.1.54419 WP_000407039.1.55788 WP_000407039.1.55893 WP_000407039.1.56549 WP_000407039.1.57105 WP_000407039.1.57245 WP_000407039.1.58328 WP_000407039.1.5841 WP_000407039.1.59016 WP_000407039.1.59075 WP_000407039.1.6 WP_000407039.1.60012 WP_000407039.1.60236 WP_000407039.1.60781 WP_000407039.1.61126 WP_000407039.1.61231 WP_000407039.1.61481 WP_000407039.1.62107 WP_000407039.1.62300 WP_000407039.1.62918 WP_000407039.1.6340 WP_000407039.1.63476 WP_000407039.1.6426 WP_000407039.1.64615 WP_000407039.1.64666 WP_000407039.1.64706 WP_000407039.1.64770 WP_000407039.1.65515 WP_000407039.1.65758 WP_000407039.1.65983 WP_000407039.1.66535 WP_000407039.1.67108 WP_000407039.1.6716 WP_000407039.1.67283 WP_000407039.1.68186 WP_000407039.1.68550 WP_000407039.1.68668 WP_000407039.1.69323 WP_000407039.1.69703 WP_000407039.1.6996 WP_000407039.1.70018 WP_000407039.1.70209 WP_000407039.1.71142 WP_000407039.1.71441 WP_000407039.1.71648 WP_000407039.1.72294 WP_000407039.1.72554 WP_000407039.1.72824 WP_000407039.1.72867 WP_000407039.1.73952 WP_000407039.1.7398 WP_000407039.1.74337 WP_000407039.1.74901 WP_000407039.1.75292 WP_000407039.1.75300 WP_000407039.1.75358 WP_000407039.1.75374 WP_000407039.1.75554 WP_000407039.1.7628 WP_000407039.1.76342 WP_000407039.1.76817 WP_000407039.1.77370 WP_000407039.1.77968 WP_000407039.1.782 WP_000407039.1.78264 WP_000407039.1.79043 WP_000407039.1.79252 WP_000407039.1.79293 WP_000407039.1.80239 WP_000407039.1.80571 WP_000407039.1.81198 WP_000407039.1.82421 WP_000407039.1.82566 WP_000407039.1.82832 WP_000407039.1.8290 WP_000407039.1.83070 WP_000407039.1.83206 WP_000407039.1.83228 WP_000407039.1.8365 WP_000407039.1.84323 WP_000407039.1.84422 WP_000407039.1.85012 WP_000407039.1.85187 WP_000407039.1.86041 WP_000407039.1.86082 WP_000407039.1.86789 WP_000407039.1.87416 WP_000407039.1.8759 WP_000407039.1.87627 WP_000407039.1.87960 WP_000407039.1.88431 WP_000407039.1.89263 WP_000407039.1.89460 WP_000407039.1.89564 WP_000407039.1.89675 WP_000407039.1.89698 WP_000407039.1.89704 WP_000407039.1.89932 WP_000407039.1.90187 WP_000407039.1.90671 WP_000407039.1.91615 WP_000407039.1.92347 WP_000407039.1.92586 WP_000407039.1.92620 WP_000407039.1.9269 WP_000407039.1.93290 WP_000407039.1.93582 WP_000407039.1.93904 WP_000407039.1.94270 WP_000407039.1.95308 WP_000407039.1.95786 WP_000407039.1.96356 WP_000407039.1.98519 WP_000407039.1.98557 WP_000407039.1.98571 WP_000407039.1.99044 WP_000407039.1.99558 WP_000407039.1.99908 gi|42782531|ref|NP_979778.1| gi|376267349|ref|YP_005120061.1| 222523.BCE_3480 315730.BcerKBAB4_3180 412694.BALH_3122 572264.BCA_3550 gi|225865439|ref|YP_002750817.1| gi|402556404|ref|YP_006597675.1| gi|118478732|ref|YP_895883.1| gi|163941100|ref|YP_001645984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]