SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941125|ref|YP_001646009.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941125|ref|YP_001646009.1|
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.65e-22
Family DNA-binding N-terminal domain of transcription activators 0.0015
Further Details:      
 
Domain Number 2 Region: 121-270
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000000392
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941125|ref|YP_001646009.1|
Sequence length 273
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MYTITEFSRICKMSTRMLRHYDKEEILKPAYVNPENGYRYYEQGQLEIALKIKKLREYKF
PLPKIKIILQSSDQDSFIKHMQSQIIELSHEVKQNLQVISEMNEMVNMNHGLNIARHRSY
DILIGMRNEMTVIAQRLQINIDDMDDYFYDLYEKVQKHNLQMVGSPSTVFYDEEYIPNKS
DVELRIPVMHGNNKDVVQEYEIKKLNPHQIVTTMHYGSYDYIGYAYIALEKWIERNGYVI
DGSPYEVYIKGPECDCLVEEYVTQICFLVMKID
Download sequence
Identical sequences A9VNL6 J8CYC8
gi|163941125|ref|YP_001646009.1| WP_002142618.1.85012 WP_002142618.1.99908 315730.BcerKBAB4_3205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]