SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941308|ref|YP_001646192.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941308|ref|YP_001646192.1|
Domain Number 1 Region: 90-235,364-529
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000383
Family Galacturonase 0.056
Further Details:      
 
Weak hits

Sequence:  gi|163941308|ref|YP_001646192.1|
Domain Number - Region: 563-750
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00102
Family Pectate lyase-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941308|ref|YP_001646192.1|
Sequence length 776
Comment hypothetical protein BcerKBAB4_3390 [Bacillus weihenstephanensis KBAB4]
Sequence
MAKFQVTCVLKSNLPVLSEGEFCFCIDTSELFIGTKKGNVKVSTENTFERLVSKLKSNTF
GGFKSRKSLVGETESANVVSGTYFLELERWNVKNDGTDADNTSKGINNALLWASQQGFIE
VVLPLGTYLIDENTPIEPQSFMTLNLGGSTLKIRSNGLVKYAIVRYQRNQKFSRVTNGRI
EGDKNTHDYTTIPHTHEWGYGIEVGNTTPAEGSNMNYISIDNMEILNCTGDGIAMESTWG
QIGEYDFAGTFEVGGISDVNGALIVDDNKIRSNLKIDLHHSSIIKWGYFGLYGDGYGGTG
SEIYTELYDVLFYRADNTFVTAAKRVKFFEEVSVPEEADYAKIVLHQGTVPTENGCKITV
RIPEFSKNVFIEKCKIHDCRRLGVSVSGAKQIYIRDCEIYKMKGTAPQGAIDIEDGYRLN
QYINIERNNIYDNQGYNVVVVGGRYINIIQNKLANNSLVVGENVEKVIISNNHLREVSCV
LSGEVTFTNNQMYATRVTIDQGDKEALIGNCTFHNSALLMGRDKAYCIQVNQCEFFSDRD
LFHTFSQLGAIIGFSAEPQTISDCVIKGGAVEGTSLTGVSPGMKNGWRLNNISFIDTKHP
QGIIMNLPPGVYTGCKFENSGTISFVTNTPQAEYEFNGCSFSWDAYNLFTVESSQRIAML
KVKNSNFRGGRWGSAFFLWDIGGRIEFNNNAFEYLNSESTDSIINFWNETFTSEFMLIEN
NIFRSNKSMIGLNAIQISSSITLIFKDNIVDTVVIKLRDEHIKKDNYINGVFDPYV
Download sequence
Identical sequences A0A1C4EMW5 A9VPY8 J9C8S6
gi|163941308|ref|YP_001646192.1| 315730.BcerKBAB4_3390 WP_002137802.1.50411 WP_002137802.1.59016 WP_002137802.1.73166 WP_002137802.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]