SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941379|ref|YP_001646263.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163941379|ref|YP_001646263.1|
Domain Number - Region: 33-82
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0824
Family Excisionase-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941379|ref|YP_001646263.1|
Sequence length 88
Comment group-specific protein [Bacillus weihenstephanensis KBAB4]
Sequence
MFNVQIDENVVKELCVEEIQKKVKEYDAELAFWDTKELKKRVCMSWNTIQDQFFFDPRFP
KFKVGKKWYFPAKQVQAFLVEWAEERMD
Download sequence
Identical sequences A0A0G8CG41 A0A1J9XY91 A0A243MWD0 A0A2B5A6H9 A0A2B6JDD9 A0A2C5FI89 A9VQY6 C2UHG7 C3AVY2
gi|163941379|ref|YP_001646263.1| WP_000483547.1.100649 WP_000483547.1.14039 WP_000483547.1.14084 WP_000483547.1.2251 WP_000483547.1.26513 WP_000483547.1.27732 WP_000483547.1.29451 WP_000483547.1.30336 WP_000483547.1.37027 WP_000483547.1.57732 WP_000483547.1.63743 WP_000483547.1.65803 WP_000483547.1.69703 WP_000483547.1.73457 WP_000483547.1.75358 WP_000483547.1.82421 WP_000483547.1.89704 WP_000483547.1.89900 WP_000483547.1.91569 WP_000483547.1.97670 WP_000483547.1.98604 WP_000483547.1.99212 WP_000483547.1.99908 315730.BcerKBAB4_3462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]