SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941381|ref|YP_001646265.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941381|ref|YP_001646265.1|
Domain Number 1 Region: 14-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000175
Family SinR domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941381|ref|YP_001646265.1|
Sequence length 82
Comment hypothetical protein BcerKBAB4_3464 [Bacillus weihenstephanensis KBAB4]
Sequence
MKNKINYPQKNLYKEIASYCGVTERYIRMIDQKERTPSMETAKKIAKFFDMNIDDIFFSN
KSNFKFFLAACWSEKNNNKEVS
Download sequence
Identical sequences A0A243MWB6 A0A2B5Q2X8 A0A2C5CFY1 A9VQY8
315730.BcerKBAB4_3464 WP_012261508.1.2251 WP_012261508.1.55893 WP_012261508.1.69703 WP_012261508.1.99908 gi|163941381|ref|YP_001646265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]