SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941387|ref|YP_001646271.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941387|ref|YP_001646271.1|
Domain Number 1 Region: 11-92
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.04e-19
Family DNA-binding N-terminal domain of transcription activators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941387|ref|YP_001646271.1|
Sequence length 129
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLIFPTRTKGNRRLFSFNDVDKLLEIK
DLLDQGLNMAGIKQVLQMKENQTEAVKVKEETKEISKSELRKILRDELQHTGRFNRTSLR
QGDISRFFH
Download sequence
Identical sequences A0A073K2Z2 A0A076W8E8 A0A150BPZ0 A0A1I5YMT6 A0A1S9WWV9 A0A243A884 A9VQZ4 C2PZ98 C2SNJ3 C2Y4B7 C3AV52 C3BNA9 J7WPG2 J8CYX8 J8D9T7 J8EYP2 J8IV96 J8KJE1 J8KJF6 J8PTR6 J9CAJ5 R8CVE2 R8D8S6 R8EQC7 R8HYP4 R8MVS1 R8Q6P7 R8T8H4 W4EEP6
gi|163941387|ref|YP_001646271.1| WP_002014475.1.10033 WP_002014475.1.100479 WP_002014475.1.100646 WP_002014475.1.100649 WP_002014475.1.101646 WP_002014475.1.10775 WP_002014475.1.10811 WP_002014475.1.11324 WP_002014475.1.17940 WP_002014475.1.20051 WP_002014475.1.20881 WP_002014475.1.21695 WP_002014475.1.22507 WP_002014475.1.24079 WP_002014475.1.26964 WP_002014475.1.27729 WP_002014475.1.27732 WP_002014475.1.28299 WP_002014475.1.2902 WP_002014475.1.2904 WP_002014475.1.30061 WP_002014475.1.31050 WP_002014475.1.35095 WP_002014475.1.36226 WP_002014475.1.37635 WP_002014475.1.37649 WP_002014475.1.37801 WP_002014475.1.38413 WP_002014475.1.38645 WP_002014475.1.39255 WP_002014475.1.39317 WP_002014475.1.4354 WP_002014475.1.4496 WP_002014475.1.45835 WP_002014475.1.46157 WP_002014475.1.47674 WP_002014475.1.47957 WP_002014475.1.48633 WP_002014475.1.50411 WP_002014475.1.52845 WP_002014475.1.54007 WP_002014475.1.56540 WP_002014475.1.57105 WP_002014475.1.59016 WP_002014475.1.60236 WP_002014475.1.63476 WP_002014475.1.6426 WP_002014475.1.64566 WP_002014475.1.65665 WP_002014475.1.68186 WP_002014475.1.68668 WP_002014475.1.71661 WP_002014475.1.72867 WP_002014475.1.72875 WP_002014475.1.73166 WP_002014475.1.74136 WP_002014475.1.75292 WP_002014475.1.76817 WP_002014475.1.79293 WP_002014475.1.82832 WP_002014475.1.8290 WP_002014475.1.84520 WP_002014475.1.84599 WP_002014475.1.85012 WP_002014475.1.85187 WP_002014475.1.85915 WP_002014475.1.86789 WP_002014475.1.87416 WP_002014475.1.89900 WP_002014475.1.91021 WP_002014475.1.93582 WP_002014475.1.936 WP_002014475.1.99044 WP_002014475.1.99558 WP_002014475.1.99908 315730.BcerKBAB4_3470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]