SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941459|ref|YP_001646343.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941459|ref|YP_001646343.1|
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily YheA/YmcA-like 3.53e-37
Family YmcA-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941459|ref|YP_001646343.1|
Sequence length 143
Comment hypothetical protein BcerKBAB4_3542 [Bacillus weihenstephanensis KBAB4]
Sequence
MKVYTKDEIVEQAKELAKMISETEEVDFFKRAEAQIHKNENVKRAIDEIKALQKQAVNLQ
HYGKWEALKKVEAEIDALQDKLDNIPVVQEFKSSQTYVNDLLQLVASTISNNVTDEILVS
TGGDVLKGETGAAVESKKGNCGC
Download sequence
Identical sequences A0A084J4B5 A0A0J6LAD2 A0A150C6T8 A0A1I5YJR4 A0A1J9UL16 A0A243A753 A9VS15 C2SNS2 C2XXN3 J7WM53 J7ZGG5 J8E1A4 J8FE88 J8FJK9 J8JTY9 J8NVI4 J8P467 J8PTA9 J9B4T2 J9BT23 R8CX48 R8D6C1 R8EMA7 R8HZV5 R8LFG7 R8MRM0 R8Q4W2 W4DQ84
315730.BcerKBAB4_3542 WP_002033698.1.100215 WP_002033698.1.100231 WP_002033698.1.10033 WP_002033698.1.100479 WP_002033698.1.100646 WP_002033698.1.100649 WP_002033698.1.10775 WP_002033698.1.11324 WP_002033698.1.17940 WP_002033698.1.20051 WP_002033698.1.20881 WP_002033698.1.21695 WP_002033698.1.23136 WP_002033698.1.27138 WP_002033698.1.27729 WP_002033698.1.27732 WP_002033698.1.2902 WP_002033698.1.2904 WP_002033698.1.30061 WP_002033698.1.35095 WP_002033698.1.36226 WP_002033698.1.37635 WP_002033698.1.37801 WP_002033698.1.38270 WP_002033698.1.38645 WP_002033698.1.39255 WP_002033698.1.39317 WP_002033698.1.39896 WP_002033698.1.42272 WP_002033698.1.4354 WP_002033698.1.4496 WP_002033698.1.45835 WP_002033698.1.46157 WP_002033698.1.47674 WP_002033698.1.47957 WP_002033698.1.49911 WP_002033698.1.50411 WP_002033698.1.50487 WP_002033698.1.52845 WP_002033698.1.53672 WP_002033698.1.53916 WP_002033698.1.54007 WP_002033698.1.57105 WP_002033698.1.59016 WP_002033698.1.60236 WP_002033698.1.63476 WP_002033698.1.6426 WP_002033698.1.64566 WP_002033698.1.65665 WP_002033698.1.67742 WP_002033698.1.68186 WP_002033698.1.68668 WP_002033698.1.71247 WP_002033698.1.72824 WP_002033698.1.72867 WP_002033698.1.75292 WP_002033698.1.75300 WP_002033698.1.76817 WP_002033698.1.82832 WP_002033698.1.8290 WP_002033698.1.84520 WP_002033698.1.84599 WP_002033698.1.85012 WP_002033698.1.85187 WP_002033698.1.86789 WP_002033698.1.87416 WP_002033698.1.89263 WP_002033698.1.89564 WP_002033698.1.89932 WP_002033698.1.93582 WP_002033698.1.99558 WP_002033698.1.99908 gi|163941459|ref|YP_001646343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]