SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941470|ref|YP_001646354.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941470|ref|YP_001646354.1|
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000262
Family SinR domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163941470|ref|YP_001646354.1|
Sequence length 308
Comment hypothetical protein BcerKBAB4_3553 [Bacillus weihenstephanensis KBAB4]
Sequence
MTELGQKLTEAREAKGLSIDQLHEITKIQKRHLVAIEEGNYDVLPGAFYARAFIKQYADA
VGLNGEELLVEYQSTIPQSEKREVPQVSTGQKTQETMQKSSSWPIADHMPKILIALLVIA
FGVVVWFVIQALTGKDDRQVQNAQSEKIEVQKAKNSPLDTKKDEAKAEEPKKEEPKKEEP
KKEEPKKEEQPAQPTGQQEVKVVGTSGKVSTLEIHNNKTLELEISAKGASYVDVKDDAGN
EILNTTVQSGQTEKRDLSTVKEVRLNIGSAPNVEIKLNGQVVTFPLDPAKEYHQRLVIKN
QGIGQAAQ
Download sequence
Identical sequences A0A0A0WJ35 A9VS26 J8F0V3
WP_002165210.1.28299 WP_002165210.1.30061 WP_002165210.1.4496 WP_002165210.1.57105 WP_002165210.1.86789 WP_002165210.1.93582 WP_002165210.1.99908 gi|163941470|ref|YP_001646354.1| 315730.BcerKBAB4_3553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]