SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941530|ref|YP_001646414.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163941530|ref|YP_001646414.1|
Domain Number - Region: 10-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000178
Family SinR domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941530|ref|YP_001646414.1|
Sequence length 195
Comment hypothetical protein BcerKBAB4_3615 [Bacillus weihenstephanensis KBAB4]
Sequence
MGTSIYCNSAIGELLQNARECCDNVQLKTKKGLSKYLGITHERLTRIESGLSKPEFELAM
DWCHATGAKLNRQAIKHIYGVGLPPTDPRLTQDVNLQLMNYIKQAEEGIKAAKEIMNLQV
ATRSWKLDEKKKHEYAVHAKEIFDTIQATQCVVQALEQVHFGIMEQIQRSWLQKAMAENV
IIQSVDSLMTLTKML
Download sequence
Identical sequences A9VS86
WP_012261574.1.99908 315730.BcerKBAB4_3615 gi|163941530|ref|YP_001646414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]