SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941533|ref|YP_001646417.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941533|ref|YP_001646417.1|
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.85e-18
Family Phage repressors 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941533|ref|YP_001646417.1|
Sequence length 123
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MIGENLRKLRKTNNLTMKDLGKKLNLAESTISGYENGNRKPDYDTLNKFADFFEVSTDYL
LGRDVAKNTSKDNEAYNPLADPDLGLWFKDIKDASPDKQEELKQFWEFIKSKEKDRKSGD
KQY
Download sequence
Identical sequences A9VS89
WP_012261577.1.99908 gi|163941533|ref|YP_001646417.1| 315730.BcerKBAB4_3618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]