SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941590|ref|YP_001646474.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941590|ref|YP_001646474.1|
Domain Number 1 Region: 4-121,190-307
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.54e-80
Family FabD-like 0.00000566
Further Details:      
 
Domain Number 2 Region: 128-193
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000000000249
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941590|ref|YP_001646474.1|
Sequence length 314
Comment malonyl CoA-acyl carrier protein transacylase [Bacillus weihenstephanensis KBAB4]
Sequence
MGKIAFLFPGQGSQAVGMGRQLAENNKEVAKVFAKADEVLHDSLSEVIFEGPQEKLTLTT
NAQPALLTTSFAILTALKEYDITPDFVAGHSLGEYSALVAAGALTFEDAVYAVRKRGEYM
EEAVPGGEGAMAAILGADPDMLKRVTEEVTSEGYAVQIANMNSTKQIVISGTKQGVELAS
QRAKENGAKRAIPLKVSGPFHSSLMKPAAEKFQSVLNEITIQDTNIPVIANVTADVITRG
TDIQAKLIEQLYSPVLWYPSIEYMVNQGVDTFIEIGPGKVLAGLMKSIDSSVKAYAVYDE
ETLKDTISNLRGES
Download sequence
Identical sequences A0A084J438 A0A1I5YGZ3 A9VT90 J8CW75 J8FJE2 J8NMN0 R8EMJ6 R8MNM1 W4DRA2
315730.BcerKBAB4_3675 gi|163941590|ref|YP_001646474.1| WP_002128825.1.10033 WP_002128825.1.100646 WP_002128825.1.100649 WP_002128825.1.20051 WP_002128825.1.20881 WP_002128825.1.21695 WP_002128825.1.27729 WP_002128825.1.27732 WP_002128825.1.2902 WP_002128825.1.2904 WP_002128825.1.35095 WP_002128825.1.36226 WP_002128825.1.39896 WP_002128825.1.4354 WP_002128825.1.45835 WP_002128825.1.60236 WP_002128825.1.63476 WP_002128825.1.6426 WP_002128825.1.68186 WP_002128825.1.72867 WP_002128825.1.75292 WP_002128825.1.8290 WP_002128825.1.85012 WP_002128825.1.85187 WP_002128825.1.87416 WP_002128825.1.93582 WP_002128825.1.99558 WP_002128825.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]