SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941635|ref|YP_001646519.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941635|ref|YP_001646519.1|
Domain Number 1 Region: 1-200,392-639
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.86e-156
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000000125
Further Details:      
 
Domain Number 2 Region: 643-917
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.55e-81
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000000171
Further Details:      
 
Domain Number 3 Region: 202-392
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 9.52e-65
Family ValRS/IleRS/LeuRS editing domain 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163941635|ref|YP_001646519.1|
Sequence length 921
Comment isoleucyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
Sequence
MEYKNTLLMPKTEFPMRGNLPKREPAMQEKWAEMNIYEKVQEHTKGRPLFVLHDGPPYAN
GDIHMGHALNKVLKDFIVRFKSMTGYCAPYVPGWDTHGLPIEQALTNKGVKRKEMTVAEF
RKLCAEYAYEQVERQREQFKRLGVRADWDNPYITLEPAYEAQQIKVFGDMAKKGYIYKGQ
KPVYWSPTSESALAEAEIEYQDKKSASIYVAFPVKDGKNVLEGDEKYIIWTTTPWTLPAN
LGISVHPELEYAIVKVNDEKYIIASELFETVAKTLEWENAEVVKTVKGSELEYTVAKHPF
YDRDSLVMLGEHVTTDAGTGCVHTAPGHGEDDFVVGKKYGLEVLCPVDDKGVLTNEAPGF
EGLFYDKANKPITEKLEEVGALLKLTFITHSYPHDWRTKKPIIFRATAQWFASIEAFRKE
LLEAVAETKWVPAWGETRLHNMVRDRGDWCISRQRAWGVPIPVFYAENGDPIITDETINH
VADLFREHGSNVWFEREAKDLLPEGFTHTGSPNGEFRKETDIMDVWFDSGSSHQAVLEER
EDLQRPADLYLEGSDQYRGWFNSSLSTAVAVTGKAPYKGVLSHGFVLDGEGRKMSKSIGN
IVVPKKIMDQLGGDILRLWVSSVDYQSDVRISDDILKQVAEVYRKIRNTFRFLLGNLDDF
NPSENTVAVAELREVDRYMLVKLNDLITKVKDAYETYDFAAVYHAIHNFCTIDLSSFYLD
FAKDILYIEGADHADRRAIQTVLYDVLVALTKLVTPILPHTADEVWPYVPGAEEESVQLT
NMPEATEVEGSEALRAKWDAFMTLRDDVLKALEVARNEKVIGKSLNASITLYPTAEMKAM
LESISEDLKQLFIVSEYKLGGTIEEAPTEAPKYEHTAVVVAQATGETCERCWVVSETIGK
DAEHETLCERCATVVKENYVK
Download sequence
Identical sequences A0A0B5SFF9 A0A1I5YE73 A9VTD5 J8IY90 J8KNL7 J8LBV3 J8NZJ1 R8EMQ3 W4DQE5
gi|163941635|ref|YP_001646519.1| 315730.BcerKBAB4_3722 WP_002128852.1.100646 WP_002128852.1.20051 WP_002128852.1.20881 WP_002128852.1.21695 WP_002128852.1.27729 WP_002128852.1.2902 WP_002128852.1.2904 WP_002128852.1.35095 WP_002128852.1.36226 WP_002128852.1.37635 WP_002128852.1.37801 WP_002128852.1.38645 WP_002128852.1.4354 WP_002128852.1.46157 WP_002128852.1.47674 WP_002128852.1.63476 WP_002128852.1.6426 WP_002128852.1.68186 WP_002128852.1.72867 WP_002128852.1.75292 WP_002128852.1.82832 WP_002128852.1.8290 WP_002128852.1.85187 WP_002128852.1.87416 WP_002128852.1.99558 WP_002128852.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]