SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941641|ref|YP_001646525.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941641|ref|YP_001646525.1|
Domain Number 1 Region: 7-268
Classification Level Classification E-value
Superfamily CNF1/YfiH-like putative cysteine hydrolases 3.11e-79
Family YfiH-like 0.000000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941641|ref|YP_001646525.1|
Sequence length 269
Comment hypothetical protein BcerKBAB4_3728 [Bacillus weihenstephanensis KBAB4]
Sequence
MREPFKYADGILYLQAWKELGNITVGFTTKDGGVSTGSFHAMNLGLHVNDIVENVHENRR
ILANKLQKPLEKWICSEQVHDHHVEKVGLQEKGKGVYSYEDGIPKTDGIYTTNKDVLLTS
CYADCVPLYFYAPSHDMIGLAHAGWKGTVTEIAKEMIQKWNAEGVSSDEIHVAIGPAIGS
CCYVVDDRVLTAAQQVVNGSVPHKVISDGQYAINLKEVNRILCVQAGIKEEHIVMSSLCT
SCEEQLFFSHRRDQGKTGRMLSFIGFKEE
Download sequence
Identical sequences A0A0B5S6Y1 A0A150C7B8 A0A243A5D3 A9VU63 J8C5F6 J8FJ99 J8P3V8 J8PSS4 R8I4Q8 R8MMS0
gi|163941641|ref|YP_001646525.1| 315730.BcerKBAB4_3728 WP_002128855.1.11324 WP_002128855.1.17940 WP_002128855.1.20881 WP_002128855.1.21695 WP_002128855.1.27729 WP_002128855.1.27732 WP_002128855.1.2904 WP_002128855.1.31050 WP_002128855.1.37635 WP_002128855.1.37801 WP_002128855.1.38645 WP_002128855.1.39896 WP_002128855.1.4354 WP_002128855.1.47674 WP_002128855.1.47957 WP_002128855.1.54007 WP_002128855.1.59016 WP_002128855.1.60236 WP_002128855.1.63476 WP_002128855.1.6426 WP_002128855.1.64566 WP_002128855.1.68186 WP_002128855.1.72867 WP_002128855.1.75292 WP_002128855.1.82832 WP_002128855.1.8290 WP_002128855.1.85012 WP_002128855.1.85187 WP_002128855.1.86789 WP_002128855.1.87416 WP_002128855.1.93582 WP_002128855.1.99558 WP_002128855.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]