SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941667|ref|YP_001646551.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941667|ref|YP_001646551.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.37e-56
Family Lysophospholipase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163941667|ref|YP_001646551.1|
Sequence length 263
Comment patatin [Bacillus weihenstephanensis KBAB4]
Sequence
MKEPKIGLALGSGGAKGFAHIGVIKVLREAGIPIHMIAGSSIGALIGTFYAASCDVERLY
RLAAVFKRKYYLDFTVPKMGFIAGKRIKDMIKMFTYNKNLEELDIPTAVVATDILKGEKV
VFTSGPIAEAVRASISVPGVFVPEKIDGRLLVDGGVIDRIPVSVVKDLGADIVIAVDVSP
IKVNGEVTSIYDVIMQSIEIMQHELVMNRQIASDLMMRPAVEQFSSRAFTHIEDIIRVGE
VEAEQHISNIYLLIEQWKEKHNV
Download sequence
Identical sequences A0A0A0WH42 A0A150C739 A9VU89 J8CLN9 J8IME2 J8NVX7 J8PBD1 J9BTM3 R8D4K6 R8I4E8
gi|163941667|ref|YP_001646551.1| 315730.BcerKBAB4_3754 WP_002138096.1.11324 WP_002138096.1.17940 WP_002138096.1.28299 WP_002138096.1.30061 WP_002138096.1.39896 WP_002138096.1.4496 WP_002138096.1.46157 WP_002138096.1.47674 WP_002138096.1.47957 WP_002138096.1.50411 WP_002138096.1.54007 WP_002138096.1.57105 WP_002138096.1.59016 WP_002138096.1.68668 WP_002138096.1.85012 WP_002138096.1.86789 WP_002138096.1.93582 WP_002138096.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]