SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941673|ref|YP_001646557.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941673|ref|YP_001646557.1|
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.31e-32
Family YmcA-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163941673|ref|YP_001646557.1|
Sequence length 150
Comment hypothetical protein BcerKBAB4_3760 [Bacillus weihenstephanensis KBAB4]
Sequence
MIVATLESVLILDKAEQLAKAIICSDIAEDYRKYYKDLQEDIEVQTLIQQFTAMKERYEE
VQRFGKYHPDYTFVSTKMRELKRSVDMHDKVATFKRAETALQKLLDEVSVAIGSEVSSSV
KVPTGNPFFDAGGCGGGCGTGGGCGCKKTG
Download sequence
Identical sequences A0A0A0WKN9 A0A150C7A9 A0A243A4T6 A9VU95 C2PZY2 C2SP20 J7ZFL1 J8IJQ3 J8KFY3 J8PVM8 R8D4I0 R8I4G4
WP_002014765.1.10033 WP_002014765.1.100649 WP_002014765.1.11324 WP_002014765.1.17940 WP_002014765.1.28299 WP_002014765.1.30061 WP_002014765.1.31050 WP_002014765.1.39896 WP_002014765.1.4496 WP_002014765.1.46157 WP_002014765.1.47674 WP_002014765.1.47957 WP_002014765.1.54007 WP_002014765.1.57105 WP_002014765.1.59016 WP_002014765.1.64566 WP_002014765.1.68668 WP_002014765.1.79293 WP_002014765.1.85012 WP_002014765.1.86789 WP_002014765.1.99908 gi|163941673|ref|YP_001646557.1| 315730.BcerKBAB4_3760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]