SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941700|ref|YP_001646584.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941700|ref|YP_001646584.1|
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily BH2638-like 7.59e-34
Family BH2638-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941700|ref|YP_001646584.1|
Sequence length 89
Comment hypothetical protein BcerKBAB4_3787 [Bacillus weihenstephanensis KBAB4]
Sequence
MEYQYPLDYNWSNEEMVAVVKFYEAIEKVYEKGVLREDLMELYRRFKEIVPSKAAEKKID
KEFQEVSGYSIYRTIQRAKEVAEKKIVKM
Download sequence
Identical sequences A0A084J3T6 A0A150C8F1 A0A243A6H0 A9VUC2 C2Q009 C2SP48 J8C5M5 J8IFZ3 J8IY26 J8LBP3 J8NZR0 R8I4Q1 R8MMS8 W4DRJ6
gi|163941700|ref|YP_001646584.1| 315730.BcerKBAB4_3787 WP_002014862.1.10033 WP_002014862.1.100649 WP_002014862.1.11324 WP_002014862.1.17940 WP_002014862.1.21695 WP_002014862.1.27732 WP_002014862.1.28299 WP_002014862.1.30061 WP_002014862.1.35095 WP_002014862.1.36226 WP_002014862.1.37635 WP_002014862.1.37801 WP_002014862.1.38645 WP_002014862.1.39255 WP_002014862.1.39896 WP_002014862.1.4354 WP_002014862.1.4496 WP_002014862.1.46157 WP_002014862.1.47674 WP_002014862.1.47957 WP_002014862.1.54007 WP_002014862.1.57105 WP_002014862.1.59016 WP_002014862.1.60236 WP_002014862.1.63476 WP_002014862.1.6426 WP_002014862.1.64566 WP_002014862.1.72867 WP_002014862.1.79293 WP_002014862.1.82832 WP_002014862.1.85012 WP_002014862.1.85187 WP_002014862.1.86789 WP_002014862.1.87416 WP_002014862.1.99558 WP_002014862.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]