SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941717|ref|YP_001646601.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941717|ref|YP_001646601.1|
Domain Number 1 Region: 11-423
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.9e-96
Family beta-CASP RNA-metabolising hydrolases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941717|ref|YP_001646601.1|
Sequence length 555
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKFLKNDQAAVFALGGLGEIGKNTYAVQFQDEIIIIDAGIKFPEDELLGIDYVIPDYTYF
VRNEDKIKGLFITHGHEDHIGGIPYLLRQVNIPIYGGKLAIALIKNKLEEHGLLRKAKLY
EIQEDDVIKFKKTSVSFFRTTHSIPDSYGVVVKTPQGQVVHTGDFKFDFTPVGEPADLTK
MAEIGKDGVLCLLSDSTNSEVPNFTMSERRVGDSIQDIFRKVDGRIIFATFASNIHRLQQ
VVEAAVENNRKVAVFGRSMEAAIEIGQNLGYIRCPKDTFIDTAQLNRLPANKVVMLCTGS
QGEPMAALSRIANGTHRQIQIIPGDTVVFSSSPIPGNTISVSRTINMLYRAGADVIHGKL
SNIHTSGHGGQEEQKLMLRLIKPKYFMPIHGEYRMQRMHMKLANDCGIPEENCFIMDNGD
VLALRSDEASVAGKIPSGSVYIDGNGIGDIGNIVLRDRRILSEEGLVIVVVSIDMKEFKV
AAGPDIISRGFVYMRESSDLINDAQTLITTHLEKVMERKTTQWSEIKNEITDTLAPFLYE
KTKRRPMILPIIMEI
Download sequence
Identical sequences A0A084J3R9 A0A150C7J7 A0A1I5Y9F0 A0A243A4I7 A9VUD9 C2SPC7 C2XYE6 J7VPT6 J7ZFQ2 J8IUU8 J8NMC3 J9C7N8 R8CW86 R8D4Q1 R8EMV8 R8I498 R8MNW9 W4DQT8
WP_002033834.1.10033 WP_002033834.1.100646 WP_002033834.1.100649 WP_002033834.1.11324 WP_002033834.1.17940 WP_002033834.1.20051 WP_002033834.1.20881 WP_002033834.1.21695 WP_002033834.1.23136 WP_002033834.1.27729 WP_002033834.1.27732 WP_002033834.1.2902 WP_002033834.1.2904 WP_002033834.1.30061 WP_002033834.1.35095 WP_002033834.1.36226 WP_002033834.1.37635 WP_002033834.1.37801 WP_002033834.1.38645 WP_002033834.1.39255 WP_002033834.1.39317 WP_002033834.1.39896 WP_002033834.1.4354 WP_002033834.1.4496 WP_002033834.1.45835 WP_002033834.1.47957 WP_002033834.1.50411 WP_002033834.1.52845 WP_002033834.1.54007 WP_002033834.1.57105 WP_002033834.1.60236 WP_002033834.1.63476 WP_002033834.1.6426 WP_002033834.1.64566 WP_002033834.1.68186 WP_002033834.1.68668 WP_002033834.1.72824 WP_002033834.1.72867 WP_002033834.1.75292 WP_002033834.1.76817 WP_002033834.1.82832 WP_002033834.1.8290 WP_002033834.1.85012 WP_002033834.1.85187 WP_002033834.1.87416 WP_002033834.1.93582 WP_002033834.1.99558 WP_002033834.1.99908 gi|163941717|ref|YP_001646601.1| 315730.BcerKBAB4_3804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]