SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941747|ref|YP_001646631.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163941747|ref|YP_001646631.1|
Domain Number - Region: 5-58
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0128
Family DNA-binding N-terminal domain of transcription activators 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941747|ref|YP_001646631.1|
Sequence length 247
Comment putative chromosome segregation ATPase [Bacillus weihenstephanensis KBAB4]
Sequence
MEAIYKTKDVTNKTGIPKHIVRKYSQLLEEHGYIISKTADARIYKLDDLKLLKSIHERAA
TLQEDISETIPIILKEKDAPPVPVIQDKQEVQPKEDGRNFEEFMLKLEMLAQLNEAIIHQ
NSTLITQNRLKDEKLDELMQQVYVKEGSQEKMLQDLVVHAAQTDALQKEKMDLLMNHMYK
RESKQEEKMNKLVNQIYNKDSNRDTQLMQVIREIQETKRLVAASKEQSFFQSFKSLFVRT
KQEKINE
Download sequence
Identical sequences A0A0A0WGV1 A0A150C7K3 A0A243A4Z6 A9VFA9 C2SPF6 J8CLW7 R8I4G7
gi|163941747|ref|YP_001646631.1| 315730.BcerKBAB4_3834 WP_002033817.1.100649 WP_002033817.1.17940 WP_002033817.1.30061 WP_002033817.1.4496 WP_002033817.1.47957 WP_002033817.1.54007 WP_002033817.1.57105 WP_002033817.1.64566 WP_002033817.1.85012 WP_002033817.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]