SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941751|ref|YP_001646635.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941751|ref|YP_001646635.1|
Domain Number 1 Region: 61-338
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.57e-74
Family L-arabinose binding protein-like 0.0000441
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.48e-17
Family GalR/LacI-like bacterial regulator 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163941751|ref|YP_001646635.1|
Sequence length 343
Comment LacI family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MTVTIKDVAKKANVAPSTVSRVIADNPSISEKTKRRVRKVMSELGYHPNLNARNLANQTT
KTLGLVMPSSASKAFQNPFFPEVIRGISSFAHVEGYALYMSTGETEDEIFNGVVKMVQGR
QIGGIILLYSRENDRIIQYLHDQNFPFVLIGKPYDRKDEITYVDNDNYTAAREVAEYLIS
LGHKQIAFIGGGSDLLVTRDRLAGMSDALKLADILLPKEYILHFDFSRESGQQAVEELMG
LKQPPTAIMATDDLIGLGVLSALSKKGFVVPKDVSIVSFNNALLSEIASPPLSTVDVNIY
QLGYEAAKALVDKVEHSESTSKCIIIPHKLLKRQTCDHYATKS
Download sequence
Identical sequences A0A084J3N7 A0A150C8K4 A0A1I5Y785 A9VFB3 C2Q059 C2SPG0 C2XYH9 J8C5T1 J8IFT4 J8IXX8 J8KN83 J8LBJ2 J8NZX6 R8CWB2 R8EN14 R8MMW9 W4DQQ3
315730.BcerKBAB4_3838 WP_002014809.1.10033 WP_002014809.1.100646 WP_002014809.1.11324 WP_002014809.1.20051 WP_002014809.1.20881 WP_002014809.1.21695 WP_002014809.1.27729 WP_002014809.1.27732 WP_002014809.1.28299 WP_002014809.1.2902 WP_002014809.1.2904 WP_002014809.1.30061 WP_002014809.1.35095 WP_002014809.1.36226 WP_002014809.1.37635 WP_002014809.1.37801 WP_002014809.1.38645 WP_002014809.1.39255 WP_002014809.1.39317 WP_002014809.1.39896 WP_002014809.1.4354 WP_002014809.1.4496 WP_002014809.1.46157 WP_002014809.1.47674 WP_002014809.1.47957 WP_002014809.1.54007 WP_002014809.1.57105 WP_002014809.1.59016 WP_002014809.1.60236 WP_002014809.1.63476 WP_002014809.1.6426 WP_002014809.1.68186 WP_002014809.1.72867 WP_002014809.1.75292 WP_002014809.1.76817 WP_002014809.1.79293 WP_002014809.1.82832 WP_002014809.1.8290 WP_002014809.1.85012 WP_002014809.1.85187 WP_002014809.1.86789 WP_002014809.1.87416 WP_002014809.1.93582 WP_002014809.1.99558 WP_002014809.1.99908 gi|163941751|ref|YP_001646635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]