SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941797|ref|YP_001646681.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941797|ref|YP_001646681.1|
Domain Number 1 Region: 45-289
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.75e-48
Family Pce catalytic domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941797|ref|YP_001646681.1|
Sequence length 300
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKGVRSILLLVSVLLCFSLNSASAKRYMMSIHTASSIHMHRQHFGKMKVSFLKVGQGDAT
LITLPNGQTMLIDGGPYEAGEVIIQKLIEKGINHLDVIVSTHPDMDHIGGLIPIVEQMPV
SLVLDSGKTYSSFTYHTYRNNIKKRGIPFISVKEGQYIPLDPHVSIQVLNNGKSKDENNE
SSIVLKIRYGKADFLLMGDADIRTENEILKQFDVHADVLKVGHHGSYTSTSETFLKKVDP
QFAILSYGSRNPYGHPHQSVVRRLKQRGIMIYGTNKRTVEIETDGEHITMGASGLMPLLK
Download sequence
Identical sequences A0A120EIU2 A0A150C7T2 A9VFF9 J8CWZ2 J8PB08 R8I3Z2
gi|163941797|ref|YP_001646681.1| 315730.BcerKBAB4_3885 WP_002143023.1.100649 WP_002143023.1.17940 WP_002143023.1.31050 WP_002143023.1.39255 WP_002143023.1.47674 WP_002143023.1.54007 WP_002143023.1.85012 WP_002143023.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]