SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941847|ref|YP_001646731.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163941847|ref|YP_001646731.1|
Domain Number 1 Region: 59-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-43
Family L-arabinose binding protein-like 0.00039
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.64e-18
Family GalR/LacI-like bacterial regulator 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163941847|ref|YP_001646731.1|
Sequence length 308
Comment LacI family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MATIRDVAKLAGVSVATVSRVINEKGYVHEDTVKQVKKAIEELHYRPNATAKPLFKQPST
VIALLVDNLHNPSYITLLRFVEEIAYKEGYQVIVCNIENKNRYIDMLEQNNIAGVIMTKS
VFRSIGEISLPFAVLEERQSLMSYYESGQKAVSLLKEKGCQFLAYIGEGVKSEEMEEHVA
GFLDTAWKEGLSYREEIVQGYTNQQFLELLQKHPYIDGVVASSDKVAIELIRAAKTLNIH
IPGKLQIIGFNGSVEGEWISPSLTTIGSYIEENGEIAFQQLIGKIKKKQVRQEEVETEFR
CIERETTK
Download sequence
Identical sequences A0A1C3TEG5 A0A243A430 A9VG43 J8CTM5
WP_002143052.1.100649 WP_002143052.1.47957 WP_002143052.1.64566 WP_002143052.1.85012 WP_002143052.1.99908 gi|163941847|ref|YP_001646731.1| 315730.BcerKBAB4_3936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]