SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163941920|ref|YP_001646804.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163941920|ref|YP_001646804.1|
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00145
Family Phage repressors 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163941920|ref|YP_001646804.1|
Sequence length 48
Comment hypothetical protein BcerKBAB4_4011 [Bacillus weihenstephanensis KBAB4]
Sequence
MRPLQISPDTAVRLSKALGVPLEQLMHMPQHILIQKLVELEKQNKDEE
Download sequence
Identical sequences A0A068NBH2 A0A0A0WMI2 A0A0B5VVX4 A0A0D1QS31 A0A0E8TDD4 A0A0F5RV19 A0A0F6FTF0 A0A0F6JFU8 A0A0G4CVF5 A0A0K6MH51 A0A125U4D5 A0A150ETF0 A0A160LEN0 A0A193CXG9 A0A1C9BYK4 A0A1G1USE8 A0A1H4ANP6 A0A1H5W5G5 A0A1I4FLB2 A0A1I5XY64 A0A1J9T834 A0A1J9TTY7 A0A1J9VFU4 A0A1J9WMI2 A0A1J9ZHT9 A0A1J9ZUI7 A0A1K0A1Y1 A0A1K0ARN9 A0A1K0B3K9 A0A1M6IQ66 A0A1M7EG47 A0A1Q9KGG6 A0A1V6LLK9 A0A1W2GG89 A0A229MNL1 A0A242W8F3 A0A242WRE1 A0A242X8E0 A0A242XJZ9 A0A242XV40 A0A242YSQ6 A0A242YV06 A0A242ZIB1 A0A242ZWR8 A0A243A3W3 A0A243AUA5 A0A243BES9 A0A243C369 A0A243CEP0 A0A243CNV3 A0A243DJZ6 A0A243DQX7 A0A243ECT0 A0A243F8H3 A0A243FIF6 A0A243GGN3 A0A243HHI7 A0A243I5U9 A0A243IQ87 A0A243J6M8 A0A243K8X3 A0A243KMD1 A0A243L1N7 A0A243M5T2 A0A243MGF3 A0A243MRA7 A0A243P2B4 A0A246PXK5 A0A246UCI7 A0A2A7E1Y6 A0A2A8V620 A0A2A9HQ62 A0A2B4FW95 A0A2B4NV48 A0A2B8V4P1 A0A2C9YZE8 A0A2C9Z310 A0A2G6QKJ2 A0A2H3QNT3 A0A2K1S0Z2 A9VGB6 B3ZEJ6 B3ZTA7 B5USW8 B7HB41 B7IXG1 B7JM21 C2MQF9 C2N642 C2NMM2 C2P3T0 C2PK47 C2Q0L7 C2QGV1 C2QXZ2 C2RD31 C2SPX2 C2T5S5 C2TL66 C2UIT8 C2V094 C2VGN4 C2VYI2 C2WSJ2 C2X2R6 C2XGI0 C2XYZ6 C2YWA8 C2ZCL3 C3E8B1 C3GNW2 D8GVC2 F0PV41 J3UUA4 J7TIW8 J7XTI9 J7Y7L3 J8CU34 J8DGD9 J8DLC8 J8F517 J8G4T5 J8G902 J8HPV0 J8ILR9 J8ISF5 J8IXE8 J8J604 J8JKT4 J8KQF8 J8MCN0 J8N9J1 J8NLN9 J8PRY0 J8QGY2 J8RAG2 J8YFF6 J9AFD4 J9APV5 J9CD80 K0FSB0 M1QRT7 N1LS92 Q3ETN4 Q731C4 Q818S5 Q81M61 R8CEB0 R8CZU7 R8D5B4 R8E008 R8E1S9 R8ENG3 R8FEB4 R8G1T3 R8GCB3 R8HI66 R8I416 R8IXC0 R8K1Z9 R8KAE0 R8LAG3 R8LLK3 R8MNC2 R8NXR2 R8PJA7 R8Q308 R8RMP5 R8TGI3 R8YLQ1 S3IKA2 V5MHR9 W4DRD8 W8Z4U2
gi|47529687|ref|YP_021036.1| gi|386738061|ref|YP_006211242.1| NP_833883.1.86172 NP_846622.1.87267 WP_001247671.1.100059 WP_001247671.1.100082 WP_001247671.1.100095 WP_001247671.1.100214 WP_001247671.1.100215 WP_001247671.1.100231 WP_001247671.1.100241 WP_001247671.1.10033 WP_001247671.1.100409 WP_001247671.1.100479 WP_001247671.1.100497 WP_001247671.1.10055 WP_001247671.1.100595 WP_001247671.1.100621 WP_001247671.1.100649 WP_001247671.1.100771 WP_001247671.1.100873 WP_001247671.1.100912 WP_001247671.1.101140 WP_001247671.1.101224 WP_001247671.1.101550 WP_001247671.1.101720 WP_001247671.1.101838 WP_001247671.1.101843 WP_001247671.1.101931 WP_001247671.1.10208 WP_001247671.1.10584 WP_001247671.1.10688 WP_001247671.1.10745 WP_001247671.1.10775 WP_001247671.1.10845 WP_001247671.1.11044 WP_001247671.1.11060 WP_001247671.1.1112 WP_001247671.1.11324 WP_001247671.1.11380 WP_001247671.1.11387 WP_001247671.1.11427 WP_001247671.1.11442 WP_001247671.1.11521 WP_001247671.1.11584 WP_001247671.1.11609 WP_001247671.1.11676 WP_001247671.1.1228 WP_001247671.1.12553 WP_001247671.1.12935 WP_001247671.1.13113 WP_001247671.1.13115 WP_001247671.1.13221 WP_001247671.1.13233 WP_001247671.1.13269 WP_001247671.1.13279 WP_001247671.1.13424 WP_001247671.1.1354 WP_001247671.1.13820 WP_001247671.1.13975 WP_001247671.1.14006 WP_001247671.1.14039 WP_001247671.1.14084 WP_001247671.1.14117 WP_001247671.1.14174 WP_001247671.1.14176 WP_001247671.1.14721 WP_001247671.1.14855 WP_001247671.1.14882 WP_001247671.1.15163 WP_001247671.1.15460 WP_001247671.1.15502 WP_001247671.1.15569 WP_001247671.1.16013 WP_001247671.1.16156 WP_001247671.1.16170 WP_001247671.1.16199 WP_001247671.1.16355 WP_001247671.1.16997 WP_001247671.1.17146 WP_001247671.1.17265 WP_001247671.1.17374 WP_001247671.1.17424 WP_001247671.1.17797 WP_001247671.1.17899 WP_001247671.1.17927 WP_001247671.1.17940 WP_001247671.1.1809 WP_001247671.1.1850 WP_001247671.1.18749 WP_001247671.1.18914 WP_001247671.1.18976 WP_001247671.1.1907 WP_001247671.1.19173 WP_001247671.1.19258 WP_001247671.1.19435 WP_001247671.1.19438 WP_001247671.1.19445 WP_001247671.1.195 WP_001247671.1.19516 WP_001247671.1.20051 WP_001247671.1.20208 WP_001247671.1.20390 WP_001247671.1.20643 WP_001247671.1.20651 WP_001247671.1.20665 WP_001247671.1.20680 WP_001247671.1.20865 WP_001247671.1.20881 WP_001247671.1.20973 WP_001247671.1.21021 WP_001247671.1.21055 WP_001247671.1.21172 WP_001247671.1.21258 WP_001247671.1.21643 WP_001247671.1.21695 WP_001247671.1.21776 WP_001247671.1.2206 WP_001247671.1.22084 WP_001247671.1.22152 WP_001247671.1.22507 WP_001247671.1.2251 WP_001247671.1.226 WP_001247671.1.22699 WP_001247671.1.22865 WP_001247671.1.22991 WP_001247671.1.23100 WP_001247671.1.23110 WP_001247671.1.23136 WP_001247671.1.23181 WP_001247671.1.23200 WP_001247671.1.23245 WP_001247671.1.23269 WP_001247671.1.23297 WP_001247671.1.23307 WP_001247671.1.23360 WP_001247671.1.23427 WP_001247671.1.23540 WP_001247671.1.23615 WP_001247671.1.23652 WP_001247671.1.23873 WP_001247671.1.2407 WP_001247671.1.24182 WP_001247671.1.2419 WP_001247671.1.24334 WP_001247671.1.24338 WP_001247671.1.24556 WP_001247671.1.24608 WP_001247671.1.24676 WP_001247671.1.24680 WP_001247671.1.24709 WP_001247671.1.24759 WP_001247671.1.24792 WP_001247671.1.24795 WP_001247671.1.24969 WP_001247671.1.24992 WP_001247671.1.2521 WP_001247671.1.25290 WP_001247671.1.25316 WP_001247671.1.25505 WP_001247671.1.25572 WP_001247671.1.25599 WP_001247671.1.2569 WP_001247671.1.25716 WP_001247671.1.25752 WP_001247671.1.25757 WP_001247671.1.26000 WP_001247671.1.2618 WP_001247671.1.26450 WP_001247671.1.26459 WP_001247671.1.26483 WP_001247671.1.26513 WP_001247671.1.26637 WP_001247671.1.26665 WP_001247671.1.26721 WP_001247671.1.26826 WP_001247671.1.26847 WP_001247671.1.26872 WP_001247671.1.26965 WP_001247671.1.27106 WP_001247671.1.27138 WP_001247671.1.27140 WP_001247671.1.27446 WP_001247671.1.27644 WP_001247671.1.27729 WP_001247671.1.27732 WP_001247671.1.27931 WP_001247671.1.27987 WP_001247671.1.28237 WP_001247671.1.28299 WP_001247671.1.28427 WP_001247671.1.28599 WP_001247671.1.28729 WP_001247671.1.28913 WP_001247671.1.2902 WP_001247671.1.2904 WP_001247671.1.29101 WP_001247671.1.29451 WP_001247671.1.29766 WP_001247671.1.29787 WP_001247671.1.29804 WP_001247671.1.29836 WP_001247671.1.29993 WP_001247671.1.30061 WP_001247671.1.30091 WP_001247671.1.30110 WP_001247671.1.30144 WP_001247671.1.30216 WP_001247671.1.3026 WP_001247671.1.30317 WP_001247671.1.30336 WP_001247671.1.31050 WP_001247671.1.31221 WP_001247671.1.3130 WP_001247671.1.31387 WP_001247671.1.31490 WP_001247671.1.31503 WP_001247671.1.3180 WP_001247671.1.3196 WP_001247671.1.3236 WP_001247671.1.3249 WP_001247671.1.32576 WP_001247671.1.32784 WP_001247671.1.32927 WP_001247671.1.33175 WP_001247671.1.33201 WP_001247671.1.33338 WP_001247671.1.33367 WP_001247671.1.33536 WP_001247671.1.33717 WP_001247671.1.33740 WP_001247671.1.33790 WP_001247671.1.33828 WP_001247671.1.33876 WP_001247671.1.34061 WP_001247671.1.34125 WP_001247671.1.34175 WP_001247671.1.34537 WP_001247671.1.34587 WP_001247671.1.34646 WP_001247671.1.35026 WP_001247671.1.35095 WP_001247671.1.35153 WP_001247671.1.35255 WP_001247671.1.3546 WP_001247671.1.3561 WP_001247671.1.35684 WP_001247671.1.35769 WP_001247671.1.35886 WP_001247671.1.3612 WP_001247671.1.36221 WP_001247671.1.36226 WP_001247671.1.36279 WP_001247671.1.36305 WP_001247671.1.36763 WP_001247671.1.3699 WP_001247671.1.37027 WP_001247671.1.37239 WP_001247671.1.37384 WP_001247671.1.37626 WP_001247671.1.37635 WP_001247671.1.37649 WP_001247671.1.37661 WP_001247671.1.37801 WP_001247671.1.3798 WP_001247671.1.38036 WP_001247671.1.38270 WP_001247671.1.38325 WP_001247671.1.38345 WP_001247671.1.38425 WP_001247671.1.38427 WP_001247671.1.38517 WP_001247671.1.38591 WP_001247671.1.38645 WP_001247671.1.39001 WP_001247671.1.3925 WP_001247671.1.39255 WP_001247671.1.39317 WP_001247671.1.39411 WP_001247671.1.39538 WP_001247671.1.39781 WP_001247671.1.39896 WP_001247671.1.39957 WP_001247671.1.40034 WP_001247671.1.4039 WP_001247671.1.40430 WP_001247671.1.40550 WP_001247671.1.40818 WP_001247671.1.40839 WP_001247671.1.41083 WP_001247671.1.41090 WP_001247671.1.41165 WP_001247671.1.41464 WP_001247671.1.41518 WP_001247671.1.41675 WP_001247671.1.41729 WP_001247671.1.4185 WP_001247671.1.41879 WP_001247671.1.41976 WP_001247671.1.42165 WP_001247671.1.42167 WP_001247671.1.42182 WP_001247671.1.42217 WP_001247671.1.42218 WP_001247671.1.42237 WP_001247671.1.42272 WP_001247671.1.42485 WP_001247671.1.42747 WP_001247671.1.42941 WP_001247671.1.43533 WP_001247671.1.4354 WP_001247671.1.4355 WP_001247671.1.43767 WP_001247671.1.43914 WP_001247671.1.44348 WP_001247671.1.4439 WP_001247671.1.44449 WP_001247671.1.44483 WP_001247671.1.44497 WP_001247671.1.4453 WP_001247671.1.44956 WP_001247671.1.4496 WP_001247671.1.45089 WP_001247671.1.45305 WP_001247671.1.45317 WP_001247671.1.45533 WP_001247671.1.45720 WP_001247671.1.45835 WP_001247671.1.45919 WP_001247671.1.46157 WP_001247671.1.46236 WP_001247671.1.46244 WP_001247671.1.46326 WP_001247671.1.46349 WP_001247671.1.46476 WP_001247671.1.4649 WP_001247671.1.46524 WP_001247671.1.46549 WP_001247671.1.46586 WP_001247671.1.46699 WP_001247671.1.47000 WP_001247671.1.47095 WP_001247671.1.47145 WP_001247671.1.473 WP_001247671.1.474 WP_001247671.1.47437 WP_001247671.1.47441 WP_001247671.1.4763 WP_001247671.1.47644 WP_001247671.1.47674 WP_001247671.1.47798 WP_001247671.1.47936 WP_001247671.1.47957 WP_001247671.1.47975 WP_001247671.1.48010 WP_001247671.1.4865 WP_001247671.1.48759 WP_001247671.1.49056 WP_001247671.1.49455 WP_001247671.1.4964 WP_001247671.1.49702 WP_001247671.1.49802 WP_001247671.1.49831 WP_001247671.1.499 WP_001247671.1.49911 WP_001247671.1.50042 WP_001247671.1.5025 WP_001247671.1.50350 WP_001247671.1.50411 WP_001247671.1.50416 WP_001247671.1.50487 WP_001247671.1.50694 WP_001247671.1.50770 WP_001247671.1.51047 WP_001247671.1.51072 WP_001247671.1.51099 WP_001247671.1.51167 WP_001247671.1.51335 WP_001247671.1.51556 WP_001247671.1.51656 WP_001247671.1.51749 WP_001247671.1.52284 WP_001247671.1.52494 WP_001247671.1.52532 WP_001247671.1.52794 WP_001247671.1.52932 WP_001247671.1.53137 WP_001247671.1.53493 WP_001247671.1.53621 WP_001247671.1.53672 WP_001247671.1.53683 WP_001247671.1.53879 WP_001247671.1.53916 WP_001247671.1.54007 WP_001247671.1.54117 WP_001247671.1.54142 WP_001247671.1.54189 WP_001247671.1.54240 WP_001247671.1.54419 WP_001247671.1.54547 WP_001247671.1.54736 WP_001247671.1.54777 WP_001247671.1.55077 WP_001247671.1.55116 WP_001247671.1.5543 WP_001247671.1.55788 WP_001247671.1.55811 WP_001247671.1.55893 WP_001247671.1.55958 WP_001247671.1.55968 WP_001247671.1.56042 WP_001247671.1.56176 WP_001247671.1.56270 WP_001247671.1.5628 WP_001247671.1.56318 WP_001247671.1.56320 WP_001247671.1.56549 WP_001247671.1.56959 WP_001247671.1.57105 WP_001247671.1.57245 WP_001247671.1.57561 WP_001247671.1.57565 WP_001247671.1.57732 WP_001247671.1.58037 WP_001247671.1.58160 WP_001247671.1.58328 WP_001247671.1.58335 WP_001247671.1.58586 WP_001247671.1.58632 WP_001247671.1.58712 WP_001247671.1.58822 WP_001247671.1.5895 WP_001247671.1.59016 WP_001247671.1.59052 WP_001247671.1.59058 WP_001247671.1.59075 WP_001247671.1.59095 WP_001247671.1.59173 WP_001247671.1.59310 WP_001247671.1.59384 WP_001247671.1.59575 WP_001247671.1.59978 WP_001247671.1.59997 WP_001247671.1.6 WP_001247671.1.60012 WP_001247671.1.60236 WP_001247671.1.60255 WP_001247671.1.60334 WP_001247671.1.60402 WP_001247671.1.60526 WP_001247671.1.60781 WP_001247671.1.61126 WP_001247671.1.61213 WP_001247671.1.61231 WP_001247671.1.61481 WP_001247671.1.61799 WP_001247671.1.61820 WP_001247671.1.61919 WP_001247671.1.61944 WP_001247671.1.62107 WP_001247671.1.62277 WP_001247671.1.62300 WP_001247671.1.6241 WP_001247671.1.62770 WP_001247671.1.62918 WP_001247671.1.6304 WP_001247671.1.63137 WP_001247671.1.6340 WP_001247671.1.63476 WP_001247671.1.63560 WP_001247671.1.63611 WP_001247671.1.63743 WP_001247671.1.63789 WP_001247671.1.63902 WP_001247671.1.6426 WP_001247671.1.64282 WP_001247671.1.64421 WP_001247671.1.64491 WP_001247671.1.64566 WP_001247671.1.64568 WP_001247671.1.64615 WP_001247671.1.64666 WP_001247671.1.64706 WP_001247671.1.6475 WP_001247671.1.64764 WP_001247671.1.64770 WP_001247671.1.65515 WP_001247671.1.65665 WP_001247671.1.65758 WP_001247671.1.65803 WP_001247671.1.65983 WP_001247671.1.66357 WP_001247671.1.66471 WP_001247671.1.66535 WP_001247671.1.66932 WP_001247671.1.66999 WP_001247671.1.67001 WP_001247671.1.67108 WP_001247671.1.6716 WP_001247671.1.67239 WP_001247671.1.67283 WP_001247671.1.674 WP_001247671.1.6743 WP_001247671.1.67742 WP_001247671.1.67873 WP_001247671.1.67912 WP_001247671.1.68007 WP_001247671.1.68186 WP_001247671.1.68346 WP_001247671.1.6846 WP_001247671.1.68550 WP_001247671.1.68562 WP_001247671.1.68607 WP_001247671.1.68668 WP_001247671.1.69203 WP_001247671.1.69323 WP_001247671.1.69347 WP_001247671.1.69501 WP_001247671.1.69703 WP_001247671.1.69822 WP_001247671.1.69894 WP_001247671.1.6996 WP_001247671.1.69970 WP_001247671.1.70018 WP_001247671.1.70065 WP_001247671.1.70108 WP_001247671.1.70181 WP_001247671.1.70209 WP_001247671.1.70667 WP_001247671.1.7096 WP_001247671.1.70996 WP_001247671.1.71114 WP_001247671.1.71142 WP_001247671.1.71247 WP_001247671.1.71441 WP_001247671.1.71648 WP_001247671.1.71652 WP_001247671.1.71895 WP_001247671.1.71953 WP_001247671.1.72554 WP_001247671.1.72704 WP_001247671.1.72752 WP_001247671.1.72824 WP_001247671.1.72867 WP_001247671.1.73166 WP_001247671.1.73325 WP_001247671.1.73329 WP_001247671.1.73396 WP_001247671.1.73457 WP_001247671.1.73594 WP_001247671.1.73638 WP_001247671.1.73790 WP_001247671.1.73952 WP_001247671.1.7398 WP_001247671.1.74226 WP_001247671.1.74302 WP_001247671.1.74337 WP_001247671.1.74372 WP_001247671.1.74538 WP_001247671.1.74651 WP_001247671.1.74832 WP_001247671.1.74857 WP_001247671.1.74863 WP_001247671.1.74901 WP_001247671.1.74976 WP_001247671.1.75292 WP_001247671.1.75300 WP_001247671.1.7534 WP_001247671.1.75358 WP_001247671.1.75374 WP_001247671.1.7545 WP_001247671.1.75499 WP_001247671.1.75554 WP_001247671.1.75866 WP_001247671.1.75870 WP_001247671.1.75891 WP_001247671.1.7593 WP_001247671.1.75942 WP_001247671.1.76086 WP_001247671.1.76125 WP_001247671.1.76155 WP_001247671.1.7628 WP_001247671.1.76783 WP_001247671.1.76804 WP_001247671.1.76817 WP_001247671.1.76883 WP_001247671.1.76902 WP_001247671.1.77370 WP_001247671.1.77386 WP_001247671.1.77402 WP_001247671.1.77668 WP_001247671.1.77824 WP_001247671.1.77902 WP_001247671.1.77968 WP_001247671.1.782 WP_001247671.1.78264 WP_001247671.1.7856 WP_001247671.1.78644 WP_001247671.1.79043 WP_001247671.1.79250 WP_001247671.1.79252 WP_001247671.1.79293 WP_001247671.1.79315 WP_001247671.1.79549 WP_001247671.1.79584 WP_001247671.1.79687 WP_001247671.1.80126 WP_001247671.1.80239 WP_001247671.1.80439 WP_001247671.1.80571 WP_001247671.1.80622 WP_001247671.1.80649 WP_001247671.1.80695 WP_001247671.1.80955 WP_001247671.1.80964 WP_001247671.1.81000 WP_001247671.1.81198 WP_001247671.1.81570 WP_001247671.1.81773 WP_001247671.1.81799 WP_001247671.1.82289 WP_001247671.1.82421 WP_001247671.1.82566 WP_001247671.1.82832 WP_001247671.1.8290 WP_001247671.1.83070 WP_001247671.1.83206 WP_001247671.1.83228 WP_001247671.1.8365 WP_001247671.1.83666 WP_001247671.1.83694 WP_001247671.1.83938 WP_001247671.1.83951 WP_001247671.1.83977 WP_001247671.1.84045 WP_001247671.1.84323 WP_001247671.1.84422 WP_001247671.1.84520 WP_001247671.1.84541 WP_001247671.1.84599 WP_001247671.1.84614 WP_001247671.1.84775 WP_001247671.1.85012 WP_001247671.1.85187 WP_001247671.1.85348 WP_001247671.1.85592 WP_001247671.1.85667 WP_001247671.1.85689 WP_001247671.1.8577 WP_001247671.1.85901 WP_001247671.1.85928 WP_001247671.1.86041 WP_001247671.1.86082 WP_001247671.1.86119 WP_001247671.1.86140 WP_001247671.1.86239 WP_001247671.1.86288 WP_001247671.1.86374 WP_001247671.1.86619 WP_001247671.1.86637 WP_001247671.1.86763 WP_001247671.1.86789 WP_001247671.1.869 WP_001247671.1.8698 WP_001247671.1.87013 WP_001247671.1.87416 WP_001247671.1.8759 WP_001247671.1.87627 WP_001247671.1.87649 WP_001247671.1.87705 WP_001247671.1.87725 WP_001247671.1.87768 WP_001247671.1.87777 WP_001247671.1.87947 WP_001247671.1.87960 WP_001247671.1.88154 WP_001247671.1.88200 WP_001247671.1.8825 WP_001247671.1.88269 WP_001247671.1.88431 WP_001247671.1.88641 WP_001247671.1.89009 WP_001247671.1.8907 WP_001247671.1.89145 WP_001247671.1.89263 WP_001247671.1.89325 WP_001247671.1.89460 WP_001247671.1.89564 WP_001247671.1.89675 WP_001247671.1.89698 WP_001247671.1.89704 WP_001247671.1.89718 WP_001247671.1.89932 WP_001247671.1.90187 WP_001247671.1.90254 WP_001247671.1.90352 WP_001247671.1.90466 WP_001247671.1.90596 WP_001247671.1.90665 WP_001247671.1.90671 WP_001247671.1.90791 WP_001247671.1.90883 WP_001247671.1.91020 WP_001247671.1.91080 WP_001247671.1.91367 WP_001247671.1.91569 WP_001247671.1.9186 WP_001247671.1.92347 WP_001247671.1.92555 WP_001247671.1.92586 WP_001247671.1.92620 WP_001247671.1.92686 WP_001247671.1.9269 WP_001247671.1.92831 WP_001247671.1.93271 WP_001247671.1.93290 WP_001247671.1.93582 WP_001247671.1.93683 WP_001247671.1.93744 WP_001247671.1.93838 WP_001247671.1.93893 WP_001247671.1.93904 WP_001247671.1.93927 WP_001247671.1.94237 WP_001247671.1.94270 WP_001247671.1.94308 WP_001247671.1.94322 WP_001247671.1.94784 WP_001247671.1.94914 WP_001247671.1.95308 WP_001247671.1.9533 WP_001247671.1.95576 WP_001247671.1.95786 WP_001247671.1.9623 WP_001247671.1.96272 WP_001247671.1.96287 WP_001247671.1.96356 WP_001247671.1.96437 WP_001247671.1.96934 WP_001247671.1.9700 WP_001247671.1.9703 WP_001247671.1.97082 WP_001247671.1.97149 WP_001247671.1.97262 WP_001247671.1.97561 WP_001247671.1.97617 WP_001247671.1.97670 WP_001247671.1.97781 WP_001247671.1.97816 WP_001247671.1.97821 WP_001247671.1.97830 WP_001247671.1.97842 WP_001247671.1.97861 WP_001247671.1.98216 WP_001247671.1.98315 WP_001247671.1.98519 WP_001247671.1.98557 WP_001247671.1.98571 WP_001247671.1.9860 WP_001247671.1.98604 WP_001247671.1.99044 WP_001247671.1.99212 WP_001247671.1.99445 WP_001247671.1.99454 WP_001247671.1.99485 WP_001247671.1.99558 WP_001247671.1.99636 WP_001247671.1.99908 WP_001247671.1.99994 gi|384181993|ref|YP_005567755.1| gi|42783288|ref|NP_980535.1| gi|229602415|ref|YP_002868464.1| gi|227816946|ref|YP_002816955.1| gi|449091130|ref|YP_007423571.1| gi|225866152|ref|YP_002751530.1| gi|218899334|ref|YP_002447745.1| gi|30264245|ref|NP_846622.1| gi|30022252|ref|NP_833883.1| gi|163941920|ref|YP_001646804.1| gi|407706697|ref|YP_006830282.1| gi|218235303|ref|YP_002368973.1| gi|301055662|ref|YP_003793873.1| gi|402555695|ref|YP_006596966.1| gi|402564415|ref|YP_006607139.1| gi|296504660|ref|YP_003666360.1| 198094.BA_4392 222523.BCE_4242 226900.BC4168 261594.GBAA4392 315730.BcerKBAB4_4011 405531.BCG9842_B0954 405532.BCB4264_A4280 405535.BCAH820_4190 568206.BAMEG_4429 572264.BCA_4279 592021.BAA_4411 gi|218905306|ref|YP_002453140.1| gi|410676559|ref|YP_006928930.1| gi|384188241|ref|YP_005574137.1| gi|434377280|ref|YP_006611924.1| gi|452200631|ref|YP_007480712.1| gi|558682791|ref|YP_008820920.1| gi|376268067|ref|YP_005120779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]