SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942020|ref|YP_001646904.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942020|ref|YP_001646904.1|
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.28e-53
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942020|ref|YP_001646904.1|
Sequence length 209
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKWIQMPLGPLQTNAYILTNDQNECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFDH
IGAVDAVRDAFHIPVYVHKEEANWLGDATVNGSQIFMMNRSITAKPADHIIDEEGTLTIS
SFSFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLF
VLPDETAVLCGHGPETSIGFEKENNPFLQ
Download sequence
Identical sequences A0A0A0WG03 A0A150C3G9 A9VH44 C2SQ71 J8NWZ1 J8PUL6 J9BQ47 R8I3B1
gi|163942020|ref|YP_001646904.1| WP_002034035.1.100649 WP_002034035.1.11324 WP_002034035.1.17940 WP_002034035.1.30061 WP_002034035.1.31050 WP_002034035.1.39896 WP_002034035.1.4496 WP_002034035.1.46157 WP_002034035.1.47674 WP_002034035.1.47957 WP_002034035.1.50411 WP_002034035.1.54007 WP_002034035.1.57105 WP_002034035.1.59016 WP_002034035.1.93582 WP_002034035.1.99908 315730.BcerKBAB4_4114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]