SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942023|ref|YP_001646907.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942023|ref|YP_001646907.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily YqgQ-like 1.7e-22
Family YqgQ-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942023|ref|YP_001646907.1|
Sequence length 66
Comment hypothetical protein BcerKBAB4_4117 [Bacillus weihenstephanensis KBAB4]
Sequence
MVSIYDIQQLLKKFGTIIYTGDRIADLQLMQDELRELNQSQLIDPQDYQTALFLLKQEIQ
KELNKN
Download sequence
Identical sequences A0A023PB00 A0A063CIJ3 A0A0A0WGP4 A0A0B5XL30 A0A0D0REW6 A0A0D0RK98 A0A0D1R600 A0A0F6FTP0 A0A0F6JFK2 A0A0G4CX29 A0A0K0SDE7 A0A0K6MEV0 A0A0Q9FIH8 A0A0Q9GXM6 A0A0U0M8B2 A0A0W7XZN4 A0A135WUF8 A0A154ASE3 A0A158RHB2 A0A160LEW4 A0A193CXF6 A0A1A9PWQ3 A0A1C9BYP8 A0A1G1USQ2 A0A1H5WET1 A0A1J9T6K3 A0A1J9UYY5 A0A1J9WSL9 A0A1J9YQN2 A0A1J9ZWW8 A0A1K0A001 A0A1M6IIT0 A0A1M7E8Y1 A0A1S9B940 A0A1V6LMK0 A0A1W2GH34 A0A226R7Z7 A0A229MNK1 A0A242W984 A0A242WTV3 A0A242XAQ7 A0A242XKG6 A0A242YFB3 A0A242YTK4 A0A242YXU0 A0A242ZHD2 A0A242ZP35 A0A243AUN8 A0A243BCM1 A0A243C0J4 A0A243CEY3 A0A243CNM5 A0A243D9I4 A0A243DQN4 A0A243EF01 A0A243F2Y0 A0A243F6K4 A0A243FI60 A0A243HI01 A0A243IK30 A0A243ISZ8 A0A243J7A0 A0A243JWU9 A0A243KIB3 A0A243LZP4 A0A243M7N7 A0A243MR20 A0A243N3H6 A0A246Q030 A0A246UCV1 A0A2A7E1N7 A0A2A8V5Y6 A0A2A9HMH9 A0A2B4FUZ7 A0A2B4NUE5 A0A2B8V5D2 A0A2C9ZAJ5 A0A2G6QJ15 A0A2H3QCS6 A9VH47 B3ZEU1 B3ZT12 B5UT59 B7HCN6 B7IXQ7 B7JMY8 C2TLP8 C2VGY0 C2X2L2 C2YWK2 C3DQ74 C3G875 D8GVL7 G9Q1Q4 J3UU28 J7WFN6 J7WQG9 J7Z1E9 J8C3B5 J8DFZ3 J8FH32 J8H2K7 J8IL00 J8JRF2 J8KTH3 J8L2X6 J8MA82 J8MGB1 J8MKU2 J8R0J7 J8WYA6 J9APH9 J9CCZ6 K0FU90 M1PQM4 N1LN13 Q3EX44 Q812T5 Q81LX1 R8CE38 R8E0B8 R8E1F1 R8FER4 R8G1Y0 R8GCG4 R8GT97 R8I3G8 R8IWK7 R8K282 R8LB20 R8LKS6 R8PK68 R8RLB6 R8TFJ1 R8YRY9 S3IK17 V5MFF0 W8Z531
gi|30264336|ref|NP_846713.1| gi|218905400|ref|YP_002453234.1| gi|402555599|ref|YP_006596870.1| gi|449091226|ref|YP_007423667.1| gi|296504761|ref|YP_003666461.1| gi|301055757|ref|YP_003793968.1| gi|410676655|ref|YP_006929026.1| gi|30022344|ref|NP_833975.1| gi|384188337|ref|YP_005574233.1| gi|225866246|ref|YP_002751624.1| gi|47778301|ref|YP_021132.2| gi|218899430|ref|YP_002447841.1| 198094.BA_4488 226900.BC4261 261594.GBAA4488 315730.BcerKBAB4_4117 405531.BCG9842_B0856 405532.BCB4264_A4378 405535.BCAH820_4284 568206.BAMEG_4524 572264.BCA_4375 592021.BAA_4507 gi|163942023|ref|YP_001646907.1| gi|558682888|ref|YP_008821017.1| gi|407706793|ref|YP_006830378.1| gi|218235799|ref|YP_002369069.1| NP_833975.1.86172 NP_846713.1.87267 WP_000253699.1.100059 WP_000253699.1.100082 WP_000253699.1.100095 WP_000253699.1.100214 WP_000253699.1.100215 WP_000253699.1.100409 WP_000253699.1.100497 WP_000253699.1.10055 WP_000253699.1.100595 WP_000253699.1.100649 WP_000253699.1.100771 WP_000253699.1.100912 WP_000253699.1.101140 WP_000253699.1.101224 WP_000253699.1.101550 WP_000253699.1.101720 WP_000253699.1.101838 WP_000253699.1.101931 WP_000253699.1.10208 WP_000253699.1.10584 WP_000253699.1.10688 WP_000253699.1.10745 WP_000253699.1.10775 WP_000253699.1.10845 WP_000253699.1.11060 WP_000253699.1.1112 WP_000253699.1.11380 WP_000253699.1.11387 WP_000253699.1.11427 WP_000253699.1.11442 WP_000253699.1.11521 WP_000253699.1.11584 WP_000253699.1.11676 WP_000253699.1.12289 WP_000253699.1.12553 WP_000253699.1.12935 WP_000253699.1.13113 WP_000253699.1.13115 WP_000253699.1.13221 WP_000253699.1.13233 WP_000253699.1.13269 WP_000253699.1.13279 WP_000253699.1.13424 WP_000253699.1.13498 WP_000253699.1.1354 WP_000253699.1.13820 WP_000253699.1.13975 WP_000253699.1.14006 WP_000253699.1.14039 WP_000253699.1.14084 WP_000253699.1.14174 WP_000253699.1.14176 WP_000253699.1.14721 WP_000253699.1.14855 WP_000253699.1.14882 WP_000253699.1.15163 WP_000253699.1.15460 WP_000253699.1.15502 WP_000253699.1.15569 WP_000253699.1.16013 WP_000253699.1.16156 WP_000253699.1.16170 WP_000253699.1.16997 WP_000253699.1.17146 WP_000253699.1.17265 WP_000253699.1.17374 WP_000253699.1.17424 WP_000253699.1.17797 WP_000253699.1.17940 WP_000253699.1.1809 WP_000253699.1.1850 WP_000253699.1.18749 WP_000253699.1.18914 WP_000253699.1.18976 WP_000253699.1.1907 WP_000253699.1.19173 WP_000253699.1.19258 WP_000253699.1.19435 WP_000253699.1.19438 WP_000253699.1.19445 WP_000253699.1.195 WP_000253699.1.19516 WP_000253699.1.20208 WP_000253699.1.20390 WP_000253699.1.20643 WP_000253699.1.20651 WP_000253699.1.20665 WP_000253699.1.20680 WP_000253699.1.20865 WP_000253699.1.20973 WP_000253699.1.21021 WP_000253699.1.21055 WP_000253699.1.21258 WP_000253699.1.21776 WP_000253699.1.2206 WP_000253699.1.22084 WP_000253699.1.22152 WP_000253699.1.22507 WP_000253699.1.2251 WP_000253699.1.226 WP_000253699.1.22699 WP_000253699.1.22865 WP_000253699.1.22991 WP_000253699.1.23110 WP_000253699.1.23136 WP_000253699.1.23181 WP_000253699.1.23200 WP_000253699.1.23245 WP_000253699.1.23269 WP_000253699.1.23297 WP_000253699.1.23307 WP_000253699.1.23360 WP_000253699.1.23427 WP_000253699.1.23540 WP_000253699.1.23615 WP_000253699.1.23652 WP_000253699.1.23873 WP_000253699.1.2407 WP_000253699.1.24182 WP_000253699.1.2419 WP_000253699.1.24334 WP_000253699.1.24338 WP_000253699.1.24556 WP_000253699.1.24608 WP_000253699.1.24676 WP_000253699.1.24680 WP_000253699.1.24759 WP_000253699.1.24792 WP_000253699.1.24795 WP_000253699.1.24969 WP_000253699.1.24992 WP_000253699.1.2521 WP_000253699.1.25290 WP_000253699.1.25316 WP_000253699.1.25572 WP_000253699.1.25599 WP_000253699.1.2569 WP_000253699.1.25716 WP_000253699.1.25752 WP_000253699.1.25757 WP_000253699.1.26000 WP_000253699.1.2618 WP_000253699.1.26450 WP_000253699.1.26459 WP_000253699.1.26483 WP_000253699.1.26513 WP_000253699.1.26637 WP_000253699.1.26665 WP_000253699.1.26721 WP_000253699.1.26826 WP_000253699.1.26847 WP_000253699.1.26872 WP_000253699.1.26965 WP_000253699.1.27106 WP_000253699.1.27138 WP_000253699.1.27140 WP_000253699.1.27446 WP_000253699.1.27644 WP_000253699.1.27931 WP_000253699.1.27987 WP_000253699.1.28237 WP_000253699.1.28427 WP_000253699.1.28599 WP_000253699.1.28729 WP_000253699.1.28913 WP_000253699.1.29101 WP_000253699.1.29451 WP_000253699.1.29766 WP_000253699.1.29787 WP_000253699.1.29804 WP_000253699.1.29836 WP_000253699.1.29993 WP_000253699.1.30061 WP_000253699.1.30110 WP_000253699.1.30144 WP_000253699.1.30216 WP_000253699.1.3026 WP_000253699.1.30317 WP_000253699.1.30336 WP_000253699.1.30788 WP_000253699.1.31221 WP_000253699.1.3130 WP_000253699.1.31490 WP_000253699.1.31503 WP_000253699.1.3180 WP_000253699.1.3196 WP_000253699.1.3236 WP_000253699.1.3249 WP_000253699.1.32576 WP_000253699.1.32784 WP_000253699.1.32927 WP_000253699.1.33175 WP_000253699.1.33201 WP_000253699.1.33338 WP_000253699.1.33367 WP_000253699.1.33536 WP_000253699.1.33717 WP_000253699.1.33740 WP_000253699.1.33790 WP_000253699.1.33828 WP_000253699.1.33876 WP_000253699.1.34061 WP_000253699.1.34125 WP_000253699.1.34158 WP_000253699.1.34175 WP_000253699.1.34537 WP_000253699.1.34587 WP_000253699.1.34646 WP_000253699.1.35153 WP_000253699.1.3546 WP_000253699.1.35518 WP_000253699.1.3561 WP_000253699.1.35684 WP_000253699.1.35694 WP_000253699.1.35769 WP_000253699.1.35886 WP_000253699.1.3612 WP_000253699.1.36221 WP_000253699.1.36279 WP_000253699.1.36305 WP_000253699.1.36763 WP_000253699.1.3699 WP_000253699.1.37027 WP_000253699.1.37239 WP_000253699.1.37384 WP_000253699.1.37626 WP_000253699.1.37649 WP_000253699.1.37661 WP_000253699.1.3798 WP_000253699.1.38036 WP_000253699.1.38325 WP_000253699.1.38345 WP_000253699.1.38427 WP_000253699.1.38517 WP_000253699.1.38591 WP_000253699.1.39001 WP_000253699.1.3925 WP_000253699.1.39411 WP_000253699.1.39538 WP_000253699.1.39781 WP_000253699.1.39957 WP_000253699.1.40034 WP_000253699.1.4039 WP_000253699.1.40430 WP_000253699.1.40550 WP_000253699.1.40818 WP_000253699.1.40839 WP_000253699.1.41090 WP_000253699.1.41165 WP_000253699.1.41365 WP_000253699.1.41464 WP_000253699.1.41518 WP_000253699.1.41675 WP_000253699.1.4185 WP_000253699.1.41879 WP_000253699.1.42165 WP_000253699.1.42167 WP_000253699.1.42182 WP_000253699.1.42217 WP_000253699.1.42218 WP_000253699.1.42237 WP_000253699.1.42272 WP_000253699.1.42485 WP_000253699.1.42747 WP_000253699.1.42941 WP_000253699.1.43434 WP_000253699.1.43442 WP_000253699.1.4355 WP_000253699.1.43767 WP_000253699.1.43914 WP_000253699.1.44348 WP_000253699.1.4439 WP_000253699.1.44428 WP_000253699.1.44449 WP_000253699.1.4447 WP_000253699.1.44483 WP_000253699.1.44497 WP_000253699.1.4453 WP_000253699.1.44956 WP_000253699.1.4496 WP_000253699.1.45089 WP_000253699.1.45305 WP_000253699.1.45317 WP_000253699.1.45385 WP_000253699.1.45533 WP_000253699.1.45720 WP_000253699.1.45919 WP_000253699.1.46236 WP_000253699.1.46326 WP_000253699.1.46349 WP_000253699.1.46476 WP_000253699.1.4649 WP_000253699.1.46524 WP_000253699.1.46549 WP_000253699.1.46586 WP_000253699.1.46699 WP_000253699.1.47000 WP_000253699.1.47095 WP_000253699.1.47145 WP_000253699.1.474 WP_000253699.1.47437 WP_000253699.1.4763 WP_000253699.1.47644 WP_000253699.1.47798 WP_000253699.1.47936 WP_000253699.1.47957 WP_000253699.1.47975 WP_000253699.1.4865 WP_000253699.1.48759 WP_000253699.1.49455 WP_000253699.1.4964 WP_000253699.1.49702 WP_000253699.1.49802 WP_000253699.1.49831 WP_000253699.1.499 WP_000253699.1.50042 WP_000253699.1.50350 WP_000253699.1.50416 WP_000253699.1.50487 WP_000253699.1.50694 WP_000253699.1.50770 WP_000253699.1.51047 WP_000253699.1.51072 WP_000253699.1.51099 WP_000253699.1.51167 WP_000253699.1.51335 WP_000253699.1.51656 WP_000253699.1.51681 WP_000253699.1.51749 WP_000253699.1.52284 WP_000253699.1.52494 WP_000253699.1.52532 WP_000253699.1.52794 WP_000253699.1.52845 WP_000253699.1.52932 WP_000253699.1.53137 WP_000253699.1.53493 WP_000253699.1.53621 WP_000253699.1.53672 WP_000253699.1.53683 WP_000253699.1.53879 WP_000253699.1.53916 WP_000253699.1.54007 WP_000253699.1.54116 WP_000253699.1.54117 WP_000253699.1.54142 WP_000253699.1.54189 WP_000253699.1.54240 WP_000253699.1.54419 WP_000253699.1.54547 WP_000253699.1.54736 WP_000253699.1.54777 WP_000253699.1.55077 WP_000253699.1.55116 WP_000253699.1.5543 WP_000253699.1.55788 WP_000253699.1.55811 WP_000253699.1.55893 WP_000253699.1.55958 WP_000253699.1.55968 WP_000253699.1.56042 WP_000253699.1.56176 WP_000253699.1.56270 WP_000253699.1.56318 WP_000253699.1.56320 WP_000253699.1.56549 WP_000253699.1.56580 WP_000253699.1.56959 WP_000253699.1.57105 WP_000253699.1.57561 WP_000253699.1.57732 WP_000253699.1.58160 WP_000253699.1.58335 WP_000253699.1.5841 WP_000253699.1.58586 WP_000253699.1.58632 WP_000253699.1.58712 WP_000253699.1.58822 WP_000253699.1.5895 WP_000253699.1.59052 WP_000253699.1.59058 WP_000253699.1.59075 WP_000253699.1.59095 WP_000253699.1.59173 WP_000253699.1.59310 WP_000253699.1.59384 WP_000253699.1.59575 WP_000253699.1.59978 WP_000253699.1.59997 WP_000253699.1.60012 WP_000253699.1.60153 WP_000253699.1.60255 WP_000253699.1.60334 WP_000253699.1.60402 WP_000253699.1.60526 WP_000253699.1.60781 WP_000253699.1.60841 WP_000253699.1.61213 WP_000253699.1.61243 WP_000253699.1.61481 WP_000253699.1.61799 WP_000253699.1.61820 WP_000253699.1.61919 WP_000253699.1.61944 WP_000253699.1.62107 WP_000253699.1.62277 WP_000253699.1.62300 WP_000253699.1.6241 WP_000253699.1.62770 WP_000253699.1.62918 WP_000253699.1.6304 WP_000253699.1.63137 WP_000253699.1.6340 WP_000253699.1.63560 WP_000253699.1.63611 WP_000253699.1.63743 WP_000253699.1.63789 WP_000253699.1.63902 WP_000253699.1.64282 WP_000253699.1.64421 WP_000253699.1.64491 WP_000253699.1.64568 WP_000253699.1.64615 WP_000253699.1.64666 WP_000253699.1.64706 WP_000253699.1.6475 WP_000253699.1.64764 WP_000253699.1.64770 WP_000253699.1.65758 WP_000253699.1.65803 WP_000253699.1.65983 WP_000253699.1.66331 WP_000253699.1.66357 WP_000253699.1.66535 WP_000253699.1.66932 WP_000253699.1.66999 WP_000253699.1.67001 WP_000253699.1.67108 WP_000253699.1.6716 WP_000253699.1.67239 WP_000253699.1.67283 WP_000253699.1.674 WP_000253699.1.6743 WP_000253699.1.67873 WP_000253699.1.67912 WP_000253699.1.68007 WP_000253699.1.6816 WP_000253699.1.68346 WP_000253699.1.6846 WP_000253699.1.68562 WP_000253699.1.68607 WP_000253699.1.69203 WP_000253699.1.69323 WP_000253699.1.69501 WP_000253699.1.69703 WP_000253699.1.69822 WP_000253699.1.69894 WP_000253699.1.70018 WP_000253699.1.70065 WP_000253699.1.70108 WP_000253699.1.70181 WP_000253699.1.70209 WP_000253699.1.70667 WP_000253699.1.7096 WP_000253699.1.70996 WP_000253699.1.71114 WP_000253699.1.71142 WP_000253699.1.71242 WP_000253699.1.71441 WP_000253699.1.71648 WP_000253699.1.71652 WP_000253699.1.71895 WP_000253699.1.71953 WP_000253699.1.72484 WP_000253699.1.72554 WP_000253699.1.72704 WP_000253699.1.72752 WP_000253699.1.72824 WP_000253699.1.73325 WP_000253699.1.73329 WP_000253699.1.73396 WP_000253699.1.73457 WP_000253699.1.73594 WP_000253699.1.73638 WP_000253699.1.73790 WP_000253699.1.7398 WP_000253699.1.74226 WP_000253699.1.74302 WP_000253699.1.74337 WP_000253699.1.74372 WP_000253699.1.74538 WP_000253699.1.74651 WP_000253699.1.74832 WP_000253699.1.74857 WP_000253699.1.74863 WP_000253699.1.74901 WP_000253699.1.74976 WP_000253699.1.75300 WP_000253699.1.7534 WP_000253699.1.75358 WP_000253699.1.75374 WP_000253699.1.7544 WP_000253699.1.7545 WP_000253699.1.75499 WP_000253699.1.75554 WP_000253699.1.75866 WP_000253699.1.75870 WP_000253699.1.75891 WP_000253699.1.7593 WP_000253699.1.75942 WP_000253699.1.76086 WP_000253699.1.76125 WP_000253699.1.76155 WP_000253699.1.7628 WP_000253699.1.76342 WP_000253699.1.76783 WP_000253699.1.76804 WP_000253699.1.76883 WP_000253699.1.76902 WP_000253699.1.77370 WP_000253699.1.77386 WP_000253699.1.77402 WP_000253699.1.77567 WP_000253699.1.77668 WP_000253699.1.77824 WP_000253699.1.77902 WP_000253699.1.77968 WP_000253699.1.782 WP_000253699.1.78264 WP_000253699.1.7856 WP_000253699.1.78644 WP_000253699.1.79043 WP_000253699.1.79315 WP_000253699.1.79549 WP_000253699.1.79584 WP_000253699.1.80126 WP_000253699.1.80239 WP_000253699.1.80439 WP_000253699.1.80571 WP_000253699.1.80622 WP_000253699.1.80649 WP_000253699.1.80695 WP_000253699.1.81000 WP_000253699.1.81198 WP_000253699.1.81570 WP_000253699.1.81773 WP_000253699.1.81799 WP_000253699.1.82289 WP_000253699.1.82566 WP_000253699.1.83206 WP_000253699.1.83228 WP_000253699.1.8365 WP_000253699.1.83666 WP_000253699.1.83694 WP_000253699.1.83938 WP_000253699.1.83951 WP_000253699.1.83977 WP_000253699.1.84045 WP_000253699.1.84323 WP_000253699.1.84541 WP_000253699.1.84614 WP_000253699.1.84775 WP_000253699.1.85012 WP_000253699.1.85348 WP_000253699.1.85592 WP_000253699.1.85667 WP_000253699.1.85689 WP_000253699.1.8577 WP_000253699.1.85901 WP_000253699.1.85928 WP_000253699.1.86041 WP_000253699.1.86082 WP_000253699.1.86119 WP_000253699.1.86140 WP_000253699.1.86239 WP_000253699.1.86288 WP_000253699.1.86374 WP_000253699.1.86619 WP_000253699.1.86637 WP_000253699.1.86763 WP_000253699.1.869 WP_000253699.1.8698 WP_000253699.1.87013 WP_000253699.1.8759 WP_000253699.1.87649 WP_000253699.1.87705 WP_000253699.1.87725 WP_000253699.1.87768 WP_000253699.1.87777 WP_000253699.1.87873 WP_000253699.1.87947 WP_000253699.1.87960 WP_000253699.1.88154 WP_000253699.1.88200 WP_000253699.1.8825 WP_000253699.1.88269 WP_000253699.1.88431 WP_000253699.1.88641 WP_000253699.1.89009 WP_000253699.1.8907 WP_000253699.1.89145 WP_000253699.1.89263 WP_000253699.1.89325 WP_000253699.1.89460 WP_000253699.1.89564 WP_000253699.1.89698 WP_000253699.1.89704 WP_000253699.1.89718 WP_000253699.1.89932 WP_000253699.1.90155 WP_000253699.1.90187 WP_000253699.1.90254 WP_000253699.1.90352 WP_000253699.1.90452 WP_000253699.1.90466 WP_000253699.1.90596 WP_000253699.1.90665 WP_000253699.1.90671 WP_000253699.1.90791 WP_000253699.1.90883 WP_000253699.1.91020 WP_000253699.1.91367 WP_000253699.1.9186 WP_000253699.1.92347 WP_000253699.1.92555 WP_000253699.1.92586 WP_000253699.1.92686 WP_000253699.1.9269 WP_000253699.1.92831 WP_000253699.1.93271 WP_000253699.1.93290 WP_000253699.1.93683 WP_000253699.1.93744 WP_000253699.1.93838 WP_000253699.1.93893 WP_000253699.1.93904 WP_000253699.1.93927 WP_000253699.1.94237 WP_000253699.1.94270 WP_000253699.1.94308 WP_000253699.1.94322 WP_000253699.1.94373 WP_000253699.1.94784 WP_000253699.1.94914 WP_000253699.1.95308 WP_000253699.1.9533 WP_000253699.1.95576 WP_000253699.1.9623 WP_000253699.1.96272 WP_000253699.1.96287 WP_000253699.1.96356 WP_000253699.1.96437 WP_000253699.1.96934 WP_000253699.1.9700 WP_000253699.1.9703 WP_000253699.1.97082 WP_000253699.1.97149 WP_000253699.1.97262 WP_000253699.1.97327 WP_000253699.1.97561 WP_000253699.1.97617 WP_000253699.1.97670 WP_000253699.1.97781 WP_000253699.1.97816 WP_000253699.1.97821 WP_000253699.1.97830 WP_000253699.1.97842 WP_000253699.1.97861 WP_000253699.1.97993 WP_000253699.1.98053 WP_000253699.1.98216 WP_000253699.1.98315 WP_000253699.1.98519 WP_000253699.1.98557 WP_000253699.1.98571 WP_000253699.1.9860 WP_000253699.1.98604 WP_000253699.1.99044 WP_000253699.1.99212 WP_000253699.1.99445 WP_000253699.1.99454 WP_000253699.1.99485 WP_000253699.1.99636 WP_000253699.1.99908 WP_000253699.1.99994 gi|376268162|ref|YP_005120874.1| gi|452200730|ref|YP_007480811.1| gi|402564270|ref|YP_006606994.1| gi|434377384|ref|YP_006612028.1| gi|229602654|ref|YP_002868554.1| gi|227817039|ref|YP_002817048.1| gi|557621072|ref|YP_008782203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]