SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942081|ref|YP_001646965.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942081|ref|YP_001646965.1|
Domain Number 1 Region: 502-761
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.57e-50
Family Pce catalytic domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163942081|ref|YP_001646965.1|
Sequence length 773
Comment DNA internalization-related competence protein ComEC/Rec2 [Bacillus weihenstephanensis KBAB4]
Sequence
MNGQWGYVAISFIIGIAITFSASHLLAACCFVCYVLFCLYRTSRKTFIFCIIACFSGVMY
TTYVQSLNKPLGDSYEVTRGVVQNTPLINGDRLSFQIEDQNKNLVQLNYKIQSASEKKQL
QQLHAGISCTFKGEVKEPQTARNFHVFDYRNYLYQQKIHFIFDVTYISECQKTSLSLVQW
IFLLRQQTISKVTEMFPEQSGAFMNALLFGDRQQMTFEVEEQYQQFGLIHLLAISGSHIV
LLMVIMYFVLLRSGVTKEAATVCLIVCIPLYMIIAGASPSVVRASITGVLLLVAFMCSVR
LSSLDALSITAICMLIYDPYLIFNIGFQFSFVGSFSLLLSAPILLGRSNGIVRNSIYISI
ISQLASTPILLYHFGYFSPYSIFLNLIYVPFLSIIVLPCSIIILICMPVIPFFAKGIAYV
LSLCLTISNDFLSYCESFPFIRLTFGQTPLFLVAIYCFSIVSIFVIWERVITKKILCIVV
GVFLFISTCHYVYPYFRESGSVTFLDVGQGDAILIRLPYDKEVYLIDTGGALSVKKEAWQ
QKKHEFSVGHDILVPFLQKEGIKTIDKLIVTHGDADHIGAALDLLSSIIVKEVVFGRKEQ
DAVLEKVVKKKALEKSMKISVVGEGEGWRVNEAEFFVLAPKGKEKGENDSSIVLWARLGG
LTWLFTGDLEEEGEKFIVSIYPDLRANILKVAHHGSKTSSTDPFLSLVQPAVAIISVGER
NRYGHPHKEVIERFKKMGIDIWRTDKQGAISYVFNGEKGTFQSKITYDETHRR
Download sequence
Identical sequences A9VHV2
gi|163942081|ref|YP_001646965.1| 315730.BcerKBAB4_4176 WP_012261721.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]