SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942206|ref|YP_001647090.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942206|ref|YP_001647090.1|
Domain Number 1 Region: 6-198,346-576
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.69e-145
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000078
Further Details:      
 
Domain Number 2 Region: 577-829
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.74e-78
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000411
Further Details:      
 
Domain Number 3 Region: 196-347
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 7.19e-65
Family ValRS/IleRS/LeuRS editing domain 0.0000124
Further Details:      
 
Domain Number 4 Region: 815-879
Classification Level Classification E-value
Superfamily tRNA-binding arm 7.32e-17
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163942206|ref|YP_001647090.1|
Sequence length 881
Comment valyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
Sequence
MSNTENNLPTKYDHMSVEEGLYKWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHA
WDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKA
WEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSNAVNKVFVQLYEKDLIYRGEYIIN
WDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDD
RYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILV
MNEDGTMNEKAGKYNGMDRFECRKELVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYL
STQWFVKMAPLAEKAVELQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIP
AWYHKETGEVYVGTEAPADFENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFKKFYST
DALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDV
IEKYGADAMRYFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEID
LTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLY
GEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQ
DKEAAAEMHLLVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEVVLAQLTKNSSYIERFCN
PSELTIKIDLQAPEKAMTAIVSGAELFLPLADLINLDEEKARLEKELEKFGKEVERVQKK
LSNQGFVAKAPAEVIDGERAKEQDYLEKREAVRQRLADLEK
Download sequence
Identical sequences A9VIT2
WP_012261763.1.99908 315730.BcerKBAB4_4303 gi|163942206|ref|YP_001647090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]