SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942284|ref|YP_001647168.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942284|ref|YP_001647168.1|
Domain Number 1 Region: 338-567
Classification Level Classification E-value
Superfamily PHP domain-like 2.22e-56
Family PHP domain 0.0012
Further Details:      
 
Domain Number 2 Region: 154-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-43
Family DNA polymerase beta-like 0.0043
Further Details:      
 
Domain Number 3 Region: 2-79
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.19e-20
Family DNA polymerase beta, N-terminal domain-like 0.003
Further Details:      
 
Domain Number 4 Region: 48-145
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000000178
Family Achaeal helicase C-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942284|ref|YP_001647168.1|
Sequence length 572
Comment hypothetical protein BcerKBAB4_4381 [Bacillus weihenstephanensis KBAB4]
Sequence
MKVNKKQVIKLLETIGLFMELKGANPFKISAFRKAAAALESDDRSLSEIEDFTKIPGIGK
GTAAVIQEYIESGTSEVLQELEKEVPSSLLPLLKLPGLGGKKVAKLYKELGVVDMETLKA
VCEENKVQALAGFGKKTEEKILEAIDQVGSRPERLPIAMVLPIAGEIEEKLSNVAEIIRF
SRAGSLRRVRETVKDLDFIIATTEPAVVREHLLQFDNMIEVIASGDTKVSVRLQYEYDIS
IDFRLVKPEEFITTLHHFTGSKDHNVKMRQIAKDRGEKISEYGVEILETGEVKTFETEEA
FFAHFGLPFIPPEVREDGKEIELIKEYPNLIQFSDIQGDLHMHTTWSDGAFSIEEMVQAC
RARGYKFMAITDHSQYLKVANGLTKERLREQAKEIERMNEKYPDITILRGIEMDILPDAT
LDFDDEVLAELDYVIGAIHSSFSQDRETIMKRLRTALENKHVTMIAHPTGRLLGRREGYD
VDTDLLIQLAKETNTVLELNANPNRLDLSAKLLKQAQDAGVKVAINTDAHTLEMLEDMET
GVAAARKGWIQKDNVINTWDIERLLDYIKRNK
Download sequence
Identical sequences A0A109FY68 A0A150CER3 A9VJL3 J7VZT3 J8CSV8 J8KCM2 J8PDC8
gi|163942284|ref|YP_001647168.1| WP_002088901.1.10033 WP_002088901.1.31050 WP_002088901.1.45835 WP_002088901.1.46157 WP_002088901.1.47674 WP_002088901.1.47957 WP_002088901.1.52845 WP_002088901.1.54007 WP_002088901.1.59016 WP_002088901.1.76817 WP_002088901.1.85012 WP_002088901.1.86789 WP_002088901.1.99908 315730.BcerKBAB4_4381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]