SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942294|ref|YP_001647178.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942294|ref|YP_001647178.1|
Domain Number 1 Region: 208-405
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.49e-70
Family B3/B4 domain of PheRS, PheT 0.00000613
Further Details:      
 
Domain Number 2 Region: 475-696
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.53e-51
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000571
Further Details:      
 
Domain Number 3 Region: 36-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-49
Family Myf domain 0.0028
Further Details:      
 
Domain Number 4 Region: 708-805
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 9.81e-32
Family Anticodon-binding domain of PheRS 0.00024
Further Details:      
 
Domain Number 5 Region: 412-483
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.51e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942294|ref|YP_001647178.1|
Sequence length 806
Comment phenylalanyl-tRNA synthetase subunit beta [Bacillus weihenstephanensis KBAB4]
Sequence
MFVSYRWLQEYVDIKDVTAQELADKITKSGIEVEGVEVLNKGVKGVVVGHVLECEKHPEA
DKLSKCLIDIGEEEPVQIICGAANIAKGLKVPVAKVGAVLPGNFKIKKAKLRGEASHGMV
CALQELGIDGKFVAKEYADGIFIFPSDAEVGADALEILNLHDEVLELGLTPNRADCLNML
GVAYEVAAIYGREVKLPAIDLQETAEKTSDYISVSVEAKEENPLYIAKMVKNVKIGPSPM
WMQTRLMAAGIRPISNVVDITNYILMEYGQPLHAFDYDKLGSKEIVVRLAKEGEKIQTLD
AQERTLQSHHLVITNGTKALAVAGVMGGADSEVDSETVNVLIESAYFAGQTVRRTSKDLG
LRSESSARFEKGIDPTRTFEAIQHAAALMAKYAGGEALEGVVEADNLQVQERTVSVTAEK
VNRVLGTDISASEMGTMFTNLKFPFTEVEGTFHVNVPARRPDITISEDLVEEVGRLYGYD
HIPVTLPSGTMTRGKLTSAQTKRRKVRRFLEGAGLYEAITYSLTSADKAKQYMVEPNEKA
PVNLALPMSEERSQLRLSLVPQLLEAVSYNVARKNDSVALYEVGSIFLPTEAGELPKEEQ
HLAGVMTGLALHHAWQGEKKVVDFFVVKGVLEGLFDVLGVANQITYAPAKREGMHPGRTA
DIVLDGEAIGFIGQLHPETEKQLDVKNTFVFELSLAKVFGADAEETYYLAIPRFPSMTRD
MAVVVTTETKAGEMKQVIAEAGGELLKDVALFDLYEGEKMEEGKKSLAFSMNYFDAERTL
TDEEVTEAHNRVLTAVEEKFGAELRK
Download sequence
Identical sequences A9VJM3 R8MK67
WP_012261797.1.60236 WP_012261797.1.99908 gi|163942294|ref|YP_001647178.1| 315730.BcerKBAB4_4391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]