SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942308|ref|YP_001647192.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942308|ref|YP_001647192.1|
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily L35p-like 3.53e-22
Family Ribosomal protein L35p 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942308|ref|YP_001647192.1|
Sequence length 66
Comment 50S ribosomal protein L35 [Bacillus weihenstephanensis KBAB4]
Sequence
MPKQKTHRGAAKRFKKTGSGKLKRSHAYTSHLFANKSTKAKRKLRKAGVVSAGDFKRIRQ
MLDNLK
Download sequence
Identical sequences A0A023PBP8 A0A063CRR4 A0A073K9P2 A0A073KJ24 A0A076WH60 A0A0B5W567 A0A0D0QMI4 A0A0D0RCI9 A0A0D1NZX0 A0A0E8T9L4 A0A0F5RPZ5 A0A0F6FVS5 A0A0F6JEN9 A0A0G4CTT2 A0A0J6L7C8 A0A0K0SEE6 A0A0K6MXH0 A0A0Q9G7W0 A0A0Q9GA98 A0A0W7XYV6 A0A135WTQ3 A0A154AY09 A0A160LFG3 A0A193CY86 A0A1C9BZN9 A0A1G1UTH9 A0A1H4H313 A0A1H5SJJ3 A0A1I4EUU4 A0A1I5XAW6 A0A1J9UHJ2 A0A1J9UNT5 A0A1J9VZA7 A0A1J9WYU5 A0A1J9XRW4 A0A1J9Z1E3 A0A1J9Z257 A0A1K0AIB2 A0A1M6I499 A0A1M7FK18 A0A1Q9KS72 A0A1S8ZKG7 A0A1S9X0H4 A0A1V6LJ00 A0A1V9VXW9 A0A1W2GF33 A0A226R5E6 A0A229MQQ3 A0A229MVX5 A0A242W8L9 A0A242WGK2 A0A242X2F4 A0A242XIV4 A0A242XYL6 A0A242YDB3 A0A242ZKC2 A0A242ZR12 A0A243A4P5 A0A243APC6 A0A243AVH7 A0A243C1S9 A0A243C9F3 A0A243CQ73 A0A243DBA9 A0A243DPX0 A0A243EGZ0 A0A243ENU6 A0A243EVP8 A0A243FHB8 A0A243GES0 A0A243HIM6 A0A243I4X1 A0A243IGG9 A0A243J7R7 A0A243JNR6 A0A243JZ95 A0A243K853 A0A243LNL2 A0A243MEV4 A0A243N2Q1 A0A243NPP8 A0A246UED4 A0A2A7EDK7 A0A2A8V2S6 A0A2A9HR36 A0A2B4FPP9 A0A2B8VBL9 A0A2G6QFN7 A0A2H3Q506 A0A2K1RPF3 A0RJH3 A9VJN7 B3ZWZ1 B5UNC3 B7HF87 B7HRL3 B7IJX2 B7JR81 B9J074 C1EUR8 C2MRM4 C2N779 C2NNT0 C2P4Q0 C2Q1P8 C2QI46 C2QZ60 C2REG5 C2SA39 C2SR30 C2T754 C2TMZ6 C2UJS3 C2V1L7 C2VHS3 C2VZV6 C2WCX8 C2WTN1 C2X313 C2XHM1 C2Y042 C2ZHN7 C3ARH4 C3BQT8 C3C8T4 C3DR52 C3E9E9 C3G905 C3GPW2 C3H750 C3L8V2 C3PAG3 D8GY89 F0PJF4 G9Q0V7 J3ZWH7 J7TBG2 J7WUG1 J7YKW6 J7YXK2 J8AUN3 J8BF44 J8C260 J8E0G9 J8FDR6 J8FEA9 J8FKQ2 J8G227 J8GB76 J8H5V4 J8IHY1 J8JME6 J8JQ42 J8KVT7 J8L1H4 J8LDL5 J8MD91 J8MIR7 J8MKS7 J8MLT0 J8N071 J8N2V5 J8NBB3 J8P7A8 J8YBD7 J9AIE2 J9CF86 K0FZH3 M1QLU3 N1LSG4 Q633M2 Q6HCV6 Q72ZG3 Q817H6 Q81L16 R8CG46 R8D0X9 R8D2L1 R8E359 R8ECF2 R8EK14 R8FCH4 R8G3S2 R8GAQ9 R8GQL7 R8H6T1 R8HFI4 R8IYH8 R8K156 R8L7M7 R8L7Z4 R8LI28 R8MK41 R8NUE7 R8NUE9 R8PIX4 R8Q1Q0 R8Q4I2 R8RIQ7 R8T690 R8TCB0 R8XTZ9 S3IRH6 V5MG38 W4DPE1 W8Y9E0
gi|218231773|ref|YP_002369369.1| gi|402563913|ref|YP_006606637.1| gi|384182383|ref|YP_005568145.1| gi|218899727|ref|YP_002448138.1| gi|434377727|ref|YP_006612371.1| IDP04135 gi|407707089|ref|YP_006830674.1| gi|52140933|ref|YP_085895.1| gi|386738470|ref|YP_006211651.1| gi|557621371|ref|YP_008782502.1| gi|558683234|ref|YP_008821363.1| gi|42783751|ref|NP_980998.1| 198094.BA_4818 222523.BCE_4705 226900.BC4574 260799.BAS4470 261594.GBAA4818 281309.BT9727_4305 288681.BCZK4316 315730.BcerKBAB4_4405 361100.BCQ_4378 405531.BCG9842_B0555 405532.BCB4264_A4682 405534.BCAH187_A4698 405535.BCAH820_4689 412694.BALH_4158 568206.BAMEG_4848 572264.BCA_4683 592021.BAA_4828 gi|301056080|ref|YP_003794291.1| gi|47530115|ref|YP_021464.1| gi|229602081|ref|YP_002868853.1| gi|163942308|ref|YP_001647192.1| gi|49481333|ref|YP_038620.1| gi|402555299|ref|YP_006596570.1| gi|449091526|ref|YP_007423967.1| gi|227817358|ref|YP_002817367.1| gi|225866551|ref|YP_002751929.1| gi|376268502|ref|YP_005121214.1| gi|49187465|ref|YP_030717.1| gi|375286568|ref|YP_005107007.1| gi|30264644|ref|NP_847021.1| gi|410676970|ref|YP_006929341.1| gi|118479722|ref|YP_896873.1| NP_834280.1.86172 NP_847021.1.87267 WP_001125945.1.100059 WP_001125945.1.100082 WP_001125945.1.100095 WP_001125945.1.100214 WP_001125945.1.100215 WP_001125945.1.100231 WP_001125945.1.100241 WP_001125945.1.10033 WP_001125945.1.100409 WP_001125945.1.100479 WP_001125945.1.100497 WP_001125945.1.10055 WP_001125945.1.100595 WP_001125945.1.100621 WP_001125945.1.100646 WP_001125945.1.100649 WP_001125945.1.100684 WP_001125945.1.10069 WP_001125945.1.100771 WP_001125945.1.100873 WP_001125945.1.100912 WP_001125945.1.101224 WP_001125945.1.101309 WP_001125945.1.101550 WP_001125945.1.101646 WP_001125945.1.101720 WP_001125945.1.101838 WP_001125945.1.101843 WP_001125945.1.101931 WP_001125945.1.10208 WP_001125945.1.10584 WP_001125945.1.10688 WP_001125945.1.10745 WP_001125945.1.10762 WP_001125945.1.10775 WP_001125945.1.10811 WP_001125945.1.10845 WP_001125945.1.11044 WP_001125945.1.11060 WP_001125945.1.1112 WP_001125945.1.11324 WP_001125945.1.11380 WP_001125945.1.11387 WP_001125945.1.11427 WP_001125945.1.11442 WP_001125945.1.11521 WP_001125945.1.11584 WP_001125945.1.11609 WP_001125945.1.11676 WP_001125945.1.1228 WP_001125945.1.12289 WP_001125945.1.12553 WP_001125945.1.12751 WP_001125945.1.12935 WP_001125945.1.13024 WP_001125945.1.13113 WP_001125945.1.13115 WP_001125945.1.13221 WP_001125945.1.13233 WP_001125945.1.13269 WP_001125945.1.13279 WP_001125945.1.13299 WP_001125945.1.13424 WP_001125945.1.13498 WP_001125945.1.1354 WP_001125945.1.13820 WP_001125945.1.13975 WP_001125945.1.14006 WP_001125945.1.14039 WP_001125945.1.14084 WP_001125945.1.14117 WP_001125945.1.14174 WP_001125945.1.14176 WP_001125945.1.14721 WP_001125945.1.14855 WP_001125945.1.14882 WP_001125945.1.15163 WP_001125945.1.15460 WP_001125945.1.15569 WP_001125945.1.16013 WP_001125945.1.16156 WP_001125945.1.16170 WP_001125945.1.16199 WP_001125945.1.16355 WP_001125945.1.16997 WP_001125945.1.17146 WP_001125945.1.17374 WP_001125945.1.17408 WP_001125945.1.17424 WP_001125945.1.17797 WP_001125945.1.17899 WP_001125945.1.17927 WP_001125945.1.17940 WP_001125945.1.1850 WP_001125945.1.18749 WP_001125945.1.18840 WP_001125945.1.18914 WP_001125945.1.18976 WP_001125945.1.19173 WP_001125945.1.19258 WP_001125945.1.19435 WP_001125945.1.19438 WP_001125945.1.19445 WP_001125945.1.195 WP_001125945.1.19516 WP_001125945.1.20051 WP_001125945.1.20208 WP_001125945.1.20390 WP_001125945.1.20651 WP_001125945.1.20665 WP_001125945.1.20680 WP_001125945.1.20687 WP_001125945.1.20865 WP_001125945.1.20881 WP_001125945.1.20973 WP_001125945.1.21021 WP_001125945.1.21055 WP_001125945.1.21172 WP_001125945.1.21258 WP_001125945.1.21643 WP_001125945.1.21695 WP_001125945.1.21776 WP_001125945.1.2206 WP_001125945.1.22084 WP_001125945.1.22152 WP_001125945.1.22507 WP_001125945.1.2251 WP_001125945.1.226 WP_001125945.1.22699 WP_001125945.1.22865 WP_001125945.1.22991 WP_001125945.1.23100 WP_001125945.1.23110 WP_001125945.1.23136 WP_001125945.1.23181 WP_001125945.1.23200 WP_001125945.1.23245 WP_001125945.1.23297 WP_001125945.1.23307 WP_001125945.1.23360 WP_001125945.1.23540 WP_001125945.1.23615 WP_001125945.1.23652 WP_001125945.1.23873 WP_001125945.1.2407 WP_001125945.1.24079 WP_001125945.1.24182 WP_001125945.1.24184 WP_001125945.1.2419 WP_001125945.1.24334 WP_001125945.1.24377 WP_001125945.1.24556 WP_001125945.1.24608 WP_001125945.1.24676 WP_001125945.1.24680 WP_001125945.1.24709 WP_001125945.1.24759 WP_001125945.1.24792 WP_001125945.1.24795 WP_001125945.1.24969 WP_001125945.1.24992 WP_001125945.1.25081 WP_001125945.1.2521 WP_001125945.1.25290 WP_001125945.1.25316 WP_001125945.1.25505 WP_001125945.1.25599 WP_001125945.1.2569 WP_001125945.1.25716 WP_001125945.1.25752 WP_001125945.1.25757 WP_001125945.1.26000 WP_001125945.1.2618 WP_001125945.1.26459 WP_001125945.1.26483 WP_001125945.1.26499 WP_001125945.1.26513 WP_001125945.1.26637 WP_001125945.1.26665 WP_001125945.1.26721 WP_001125945.1.26826 WP_001125945.1.26872 WP_001125945.1.26964 WP_001125945.1.26965 WP_001125945.1.27106 WP_001125945.1.27138 WP_001125945.1.27334 WP_001125945.1.27446 WP_001125945.1.27644 WP_001125945.1.27729 WP_001125945.1.27732 WP_001125945.1.27931 WP_001125945.1.27987 WP_001125945.1.28237 WP_001125945.1.28299 WP_001125945.1.28427 WP_001125945.1.28599 WP_001125945.1.28729 WP_001125945.1.28913 WP_001125945.1.2902 WP_001125945.1.2904 WP_001125945.1.29101 WP_001125945.1.29209 WP_001125945.1.29451 WP_001125945.1.29787 WP_001125945.1.29804 WP_001125945.1.29836 WP_001125945.1.29993 WP_001125945.1.30061 WP_001125945.1.30091 WP_001125945.1.30110 WP_001125945.1.30144 WP_001125945.1.30216 WP_001125945.1.3026 WP_001125945.1.30317 WP_001125945.1.30336 WP_001125945.1.31050 WP_001125945.1.31221 WP_001125945.1.31490 WP_001125945.1.31503 WP_001125945.1.31685 WP_001125945.1.3180 WP_001125945.1.3196 WP_001125945.1.3236 WP_001125945.1.3249 WP_001125945.1.32522 WP_001125945.1.32576 WP_001125945.1.32784 WP_001125945.1.32927 WP_001125945.1.33045 WP_001125945.1.33061 WP_001125945.1.33175 WP_001125945.1.3318 WP_001125945.1.33201 WP_001125945.1.33338 WP_001125945.1.33367 WP_001125945.1.33474 WP_001125945.1.33536 WP_001125945.1.33717 WP_001125945.1.33740 WP_001125945.1.33790 WP_001125945.1.33828 WP_001125945.1.33876 WP_001125945.1.34061 WP_001125945.1.34125 WP_001125945.1.34158 WP_001125945.1.34175 WP_001125945.1.34537 WP_001125945.1.34587 WP_001125945.1.34646 WP_001125945.1.35026 WP_001125945.1.35095 WP_001125945.1.35153 WP_001125945.1.35255 WP_001125945.1.3546 WP_001125945.1.35518 WP_001125945.1.3561 WP_001125945.1.35684 WP_001125945.1.35694 WP_001125945.1.35769 WP_001125945.1.35886 WP_001125945.1.3612 WP_001125945.1.3615 WP_001125945.1.36221 WP_001125945.1.36226 WP_001125945.1.36279 WP_001125945.1.36305 WP_001125945.1.36763 WP_001125945.1.3699 WP_001125945.1.37019 WP_001125945.1.37093 WP_001125945.1.37239 WP_001125945.1.37626 WP_001125945.1.37635 WP_001125945.1.37649 WP_001125945.1.37661 WP_001125945.1.37801 WP_001125945.1.3798 WP_001125945.1.37990 WP_001125945.1.38036 WP_001125945.1.38270 WP_001125945.1.38325 WP_001125945.1.38345 WP_001125945.1.38413 WP_001125945.1.38425 WP_001125945.1.38427 WP_001125945.1.38517 WP_001125945.1.38591 WP_001125945.1.38645 WP_001125945.1.39001 WP_001125945.1.3925 WP_001125945.1.39255 WP_001125945.1.39317 WP_001125945.1.39411 WP_001125945.1.39781 WP_001125945.1.39896 WP_001125945.1.39957 WP_001125945.1.40034 WP_001125945.1.40430 WP_001125945.1.40550 WP_001125945.1.40818 WP_001125945.1.40839 WP_001125945.1.41083 WP_001125945.1.41090 WP_001125945.1.41165 WP_001125945.1.41365 WP_001125945.1.41464 WP_001125945.1.41518 WP_001125945.1.41675 WP_001125945.1.41729 WP_001125945.1.4185 WP_001125945.1.41879 WP_001125945.1.41976 WP_001125945.1.42165 WP_001125945.1.42167 WP_001125945.1.42182 WP_001125945.1.42217 WP_001125945.1.42218 WP_001125945.1.42272 WP_001125945.1.42485 WP_001125945.1.42747 WP_001125945.1.42941 WP_001125945.1.43104 WP_001125945.1.43434 WP_001125945.1.43442 WP_001125945.1.43533 WP_001125945.1.4354 WP_001125945.1.4355 WP_001125945.1.43762 WP_001125945.1.43767 WP_001125945.1.43914 WP_001125945.1.44348 WP_001125945.1.4439 WP_001125945.1.44428 WP_001125945.1.44463 WP_001125945.1.4447 WP_001125945.1.44483 WP_001125945.1.44497 WP_001125945.1.4453 WP_001125945.1.44956 WP_001125945.1.4496 WP_001125945.1.45089 WP_001125945.1.45305 WP_001125945.1.45317 WP_001125945.1.45385 WP_001125945.1.45533 WP_001125945.1.45720 WP_001125945.1.45835 WP_001125945.1.45919 WP_001125945.1.46157 WP_001125945.1.46236 WP_001125945.1.46244 WP_001125945.1.46326 WP_001125945.1.46476 WP_001125945.1.4649 WP_001125945.1.46549 WP_001125945.1.46586 WP_001125945.1.46699 WP_001125945.1.46746 WP_001125945.1.46864 WP_001125945.1.47000 WP_001125945.1.47097 WP_001125945.1.47145 WP_001125945.1.474 WP_001125945.1.47437 WP_001125945.1.47441 WP_001125945.1.4763 WP_001125945.1.47674 WP_001125945.1.47798 WP_001125945.1.47936 WP_001125945.1.47957 WP_001125945.1.47975 WP_001125945.1.48010 WP_001125945.1.48164 WP_001125945.1.48311 WP_001125945.1.48599 WP_001125945.1.48633 WP_001125945.1.4865 WP_001125945.1.48759 WP_001125945.1.49056 WP_001125945.1.49428 WP_001125945.1.49455 WP_001125945.1.4964 WP_001125945.1.49702 WP_001125945.1.49802 WP_001125945.1.49831 WP_001125945.1.499 WP_001125945.1.49911 WP_001125945.1.50042 WP_001125945.1.5025 WP_001125945.1.50316 WP_001125945.1.50411 WP_001125945.1.50487 WP_001125945.1.50514 WP_001125945.1.50694 WP_001125945.1.50770 WP_001125945.1.51047 WP_001125945.1.51072 WP_001125945.1.51087 WP_001125945.1.51167 WP_001125945.1.51335 WP_001125945.1.51656 WP_001125945.1.51681 WP_001125945.1.51749 WP_001125945.1.52284 WP_001125945.1.52494 WP_001125945.1.52532 WP_001125945.1.52756 WP_001125945.1.52794 WP_001125945.1.52845 WP_001125945.1.53137 WP_001125945.1.53493 WP_001125945.1.53621 WP_001125945.1.53672 WP_001125945.1.53683 WP_001125945.1.53879 WP_001125945.1.53916 WP_001125945.1.54007 WP_001125945.1.54116 WP_001125945.1.54117 WP_001125945.1.54142 WP_001125945.1.54189 WP_001125945.1.54240 WP_001125945.1.54419 WP_001125945.1.54547 WP_001125945.1.54736 WP_001125945.1.54775 WP_001125945.1.54777 WP_001125945.1.54782 WP_001125945.1.55057 WP_001125945.1.55077 WP_001125945.1.55116 WP_001125945.1.5543 WP_001125945.1.55811 WP_001125945.1.55893 WP_001125945.1.55958 WP_001125945.1.55968 WP_001125945.1.56042 WP_001125945.1.56055 WP_001125945.1.56176 WP_001125945.1.56270 WP_001125945.1.5628 WP_001125945.1.56318 WP_001125945.1.56320 WP_001125945.1.56540 WP_001125945.1.56580 WP_001125945.1.56959 WP_001125945.1.57105 WP_001125945.1.57203 WP_001125945.1.57245 WP_001125945.1.57561 WP_001125945.1.57565 WP_001125945.1.57732 WP_001125945.1.57815 WP_001125945.1.57859 WP_001125945.1.58037 WP_001125945.1.58160 WP_001125945.1.58328 WP_001125945.1.58335 WP_001125945.1.5841 WP_001125945.1.58586 WP_001125945.1.58632 WP_001125945.1.58712 WP_001125945.1.58814 WP_001125945.1.58822 WP_001125945.1.5895 WP_001125945.1.59016 WP_001125945.1.59052 WP_001125945.1.59058 WP_001125945.1.59095 WP_001125945.1.59173 WP_001125945.1.59310 WP_001125945.1.59384 WP_001125945.1.59575 WP_001125945.1.59773 WP_001125945.1.59978 WP_001125945.1.59997 WP_001125945.1.6 WP_001125945.1.60012 WP_001125945.1.60153 WP_001125945.1.60236 WP_001125945.1.60255 WP_001125945.1.60274 WP_001125945.1.60334 WP_001125945.1.60402 WP_001125945.1.60526 WP_001125945.1.60781 WP_001125945.1.60841 WP_001125945.1.61126 WP_001125945.1.61213 WP_001125945.1.61231 WP_001125945.1.61243 WP_001125945.1.61799 WP_001125945.1.61820 WP_001125945.1.61919 WP_001125945.1.61944 WP_001125945.1.62107 WP_001125945.1.62277 WP_001125945.1.62300 WP_001125945.1.6241 WP_001125945.1.62770 WP_001125945.1.62918 WP_001125945.1.62978 WP_001125945.1.6304 WP_001125945.1.63137 WP_001125945.1.6340 WP_001125945.1.63476 WP_001125945.1.63560 WP_001125945.1.63611 WP_001125945.1.63743 WP_001125945.1.63789 WP_001125945.1.63902 WP_001125945.1.6426 WP_001125945.1.64282 WP_001125945.1.64377 WP_001125945.1.64421 WP_001125945.1.64491 WP_001125945.1.64566 WP_001125945.1.64568 WP_001125945.1.64706 WP_001125945.1.6475 WP_001125945.1.64764 WP_001125945.1.64770 WP_001125945.1.65515 WP_001125945.1.65665 WP_001125945.1.65758 WP_001125945.1.65803 WP_001125945.1.65983 WP_001125945.1.66331 WP_001125945.1.66357 WP_001125945.1.66471 WP_001125945.1.66535 WP_001125945.1.66932 WP_001125945.1.66999 WP_001125945.1.67001 WP_001125945.1.67108 WP_001125945.1.6716 WP_001125945.1.67239 WP_001125945.1.674 WP_001125945.1.6743 WP_001125945.1.6753 WP_001125945.1.67742 WP_001125945.1.67873 WP_001125945.1.67912 WP_001125945.1.6816 WP_001125945.1.68186 WP_001125945.1.68346 WP_001125945.1.6846 WP_001125945.1.68550 WP_001125945.1.68562 WP_001125945.1.68607 WP_001125945.1.68668 WP_001125945.1.69203 WP_001125945.1.69323 WP_001125945.1.69347 WP_001125945.1.69501 WP_001125945.1.69822 WP_001125945.1.69894 WP_001125945.1.6996 WP_001125945.1.69970 WP_001125945.1.70018 WP_001125945.1.70065 WP_001125945.1.70108 WP_001125945.1.70181 WP_001125945.1.70209 WP_001125945.1.70645 WP_001125945.1.70667 WP_001125945.1.7096 WP_001125945.1.70996 WP_001125945.1.71114 WP_001125945.1.71242 WP_001125945.1.71247 WP_001125945.1.71441 WP_001125945.1.71648 WP_001125945.1.71652 WP_001125945.1.71661 WP_001125945.1.71895 WP_001125945.1.71953 WP_001125945.1.72294 WP_001125945.1.72484 WP_001125945.1.72514 WP_001125945.1.72704 WP_001125945.1.72752 WP_001125945.1.72824 WP_001125945.1.72867 WP_001125945.1.72875 WP_001125945.1.72912 WP_001125945.1.73166 WP_001125945.1.73325 WP_001125945.1.73329 WP_001125945.1.73396 WP_001125945.1.73457 WP_001125945.1.73594 WP_001125945.1.73638 WP_001125945.1.73790 WP_001125945.1.73952 WP_001125945.1.7398 WP_001125945.1.74136 WP_001125945.1.74226 WP_001125945.1.74302 WP_001125945.1.74337 WP_001125945.1.74372 WP_001125945.1.74538 WP_001125945.1.74651 WP_001125945.1.74832 WP_001125945.1.74857 WP_001125945.1.74863 WP_001125945.1.74976 WP_001125945.1.75292 WP_001125945.1.75300 WP_001125945.1.7534 WP_001125945.1.75358 WP_001125945.1.75374 WP_001125945.1.7544 WP_001125945.1.7545 WP_001125945.1.75499 WP_001125945.1.75866 WP_001125945.1.75870 WP_001125945.1.75891 WP_001125945.1.75903 WP_001125945.1.75915 WP_001125945.1.7593 WP_001125945.1.75942 WP_001125945.1.76086 WP_001125945.1.76125 WP_001125945.1.76155 WP_001125945.1.7628 WP_001125945.1.76783 WP_001125945.1.76804 WP_001125945.1.76817 WP_001125945.1.76883 WP_001125945.1.76902 WP_001125945.1.77370 WP_001125945.1.77386 WP_001125945.1.77402 WP_001125945.1.77567 WP_001125945.1.77576 WP_001125945.1.77668 WP_001125945.1.77690 WP_001125945.1.77824 WP_001125945.1.77902 WP_001125945.1.77968 WP_001125945.1.782 WP_001125945.1.7856 WP_001125945.1.78644 WP_001125945.1.79043 WP_001125945.1.79250 WP_001125945.1.79252 WP_001125945.1.79293 WP_001125945.1.79315 WP_001125945.1.79549 WP_001125945.1.79584 WP_001125945.1.79658 WP_001125945.1.79687 WP_001125945.1.80126 WP_001125945.1.80239 WP_001125945.1.80439 WP_001125945.1.80571 WP_001125945.1.80622 WP_001125945.1.80649 WP_001125945.1.80695 WP_001125945.1.80955 WP_001125945.1.80964 WP_001125945.1.81000 WP_001125945.1.81088 WP_001125945.1.81570 WP_001125945.1.81773 WP_001125945.1.81799 WP_001125945.1.82289 WP_001125945.1.82421 WP_001125945.1.82533 WP_001125945.1.82832 WP_001125945.1.8290 WP_001125945.1.82986 WP_001125945.1.83070 WP_001125945.1.83228 WP_001125945.1.83666 WP_001125945.1.83694 WP_001125945.1.83938 WP_001125945.1.83951 WP_001125945.1.83977 WP_001125945.1.84045 WP_001125945.1.84323 WP_001125945.1.84337 WP_001125945.1.84422 WP_001125945.1.8450 WP_001125945.1.84520 WP_001125945.1.84541 WP_001125945.1.84599 WP_001125945.1.84614 WP_001125945.1.84775 WP_001125945.1.85012 WP_001125945.1.85187 WP_001125945.1.85348 WP_001125945.1.85592 WP_001125945.1.85667 WP_001125945.1.85689 WP_001125945.1.8577 WP_001125945.1.85901 WP_001125945.1.85915 WP_001125945.1.85928 WP_001125945.1.86041 WP_001125945.1.86082 WP_001125945.1.86119 WP_001125945.1.86140 WP_001125945.1.86239 WP_001125945.1.86288 WP_001125945.1.86374 WP_001125945.1.86619 WP_001125945.1.86637 WP_001125945.1.86763 WP_001125945.1.86789 WP_001125945.1.869 WP_001125945.1.8698 WP_001125945.1.87013 WP_001125945.1.87416 WP_001125945.1.87627 WP_001125945.1.87649 WP_001125945.1.87705 WP_001125945.1.87725 WP_001125945.1.87768 WP_001125945.1.87777 WP_001125945.1.87873 WP_001125945.1.87947 WP_001125945.1.88154 WP_001125945.1.88200 WP_001125945.1.8825 WP_001125945.1.88269 WP_001125945.1.88431 WP_001125945.1.88641 WP_001125945.1.89009 WP_001125945.1.89145 WP_001125945.1.8923 WP_001125945.1.89263 WP_001125945.1.89325 WP_001125945.1.89460 WP_001125945.1.89564 WP_001125945.1.89675 WP_001125945.1.89698 WP_001125945.1.89718 WP_001125945.1.89900 WP_001125945.1.89932 WP_001125945.1.90155 WP_001125945.1.90254 WP_001125945.1.90352 WP_001125945.1.90452 WP_001125945.1.90466 WP_001125945.1.90596 WP_001125945.1.90665 WP_001125945.1.90671 WP_001125945.1.90791 WP_001125945.1.90883 WP_001125945.1.91020 WP_001125945.1.91021 WP_001125945.1.91080 WP_001125945.1.91367 WP_001125945.1.91404 WP_001125945.1.91569 WP_001125945.1.9186 WP_001125945.1.92347 WP_001125945.1.92555 WP_001125945.1.92620 WP_001125945.1.92686 WP_001125945.1.9269 WP_001125945.1.92831 WP_001125945.1.93271 WP_001125945.1.93582 WP_001125945.1.936 WP_001125945.1.93683 WP_001125945.1.93744 WP_001125945.1.93838 WP_001125945.1.93893 WP_001125945.1.93904 WP_001125945.1.93927 WP_001125945.1.93932 WP_001125945.1.94237 WP_001125945.1.94270 WP_001125945.1.94308 WP_001125945.1.94322 WP_001125945.1.94373 WP_001125945.1.94784 WP_001125945.1.94911 WP_001125945.1.94914 WP_001125945.1.95308 WP_001125945.1.9533 WP_001125945.1.95457 WP_001125945.1.95484 WP_001125945.1.95576 WP_001125945.1.95786 WP_001125945.1.9623 WP_001125945.1.96272 WP_001125945.1.96287 WP_001125945.1.96356 WP_001125945.1.96437 WP_001125945.1.96934 WP_001125945.1.9700 WP_001125945.1.9703 WP_001125945.1.97082 WP_001125945.1.97149 WP_001125945.1.97262 WP_001125945.1.97327 WP_001125945.1.97561 WP_001125945.1.97617 WP_001125945.1.97670 WP_001125945.1.97781 WP_001125945.1.97816 WP_001125945.1.97821 WP_001125945.1.97830 WP_001125945.1.97842 WP_001125945.1.97861 WP_001125945.1.97993 WP_001125945.1.98053 WP_001125945.1.98216 WP_001125945.1.98315 WP_001125945.1.98519 WP_001125945.1.98557 WP_001125945.1.98571 WP_001125945.1.9860 WP_001125945.1.98604 WP_001125945.1.99044 WP_001125945.1.99212 WP_001125945.1.99266 WP_001125945.1.99445 WP_001125945.1.99454 WP_001125945.1.99485 WP_001125945.1.99558 WP_001125945.1.99636 WP_001125945.1.99908 WP_001125945.1.99994 YP_030717.1.16718 YP_038620.1.62562 gi|384188648|ref|YP_005574544.1| gi|217962053|ref|YP_002340623.1| gi|30022649|ref|NP_834280.1| gi|222098036|ref|YP_002532093.1| gi|452201043|ref|YP_007481124.1| gi|218905801|ref|YP_002453635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]