SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942315|ref|YP_001647199.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942315|ref|YP_001647199.1|
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 8.83e-42
Family Bacterial S-adenosylmethionine decarboxylase 0.0000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942315|ref|YP_001647199.1|
Sequence length 130
Comment S-adenosylmethionine decarboxylase [Bacillus weihenstephanensis KBAB4]
Sequence
MDTMDTMGRHVIAELWDCDFDKLNDMPYIEQLFVDAALRAGAEVREVAFHKFAPQGVSGV
VIISESHLTIHSFPEHGYASIDVYTCGDRIDPNVAAEYIAEGLNAKTRESIELPRGTGSF
EIKQRETKAL
Download sequence
Identical sequences A0A023PD97 A0A063CLJ3 A0A084IW60 A0A0D0R5K5 A0A0D0RPG9 A0A0D1R7M0 A0A0F5RSJ4 A0A0F6JEN1 A0A0J6L827 A0A0L1NMU9 A0A0Q9FSW1 A0A0Q9G7U8 A0A0T8FXR0 A0A154AWT4 A0A158RIU3 A0A161JQL9 A0A1A9PWB1 A0A1C9BZP8 A0A1H4H2X4 A0A1H5SGE8 A0A1I4EU98 A0A1I5X9J2 A0A1J9TSJ2 A0A1J9V5L2 A0A1J9VDS0 A0A1J9VGH0 A0A1J9YXZ6 A0A1J9ZKW1 A0A1K0A8V6 A0A1K0AJR3 A0A1K0BFV2 A0A1M6Q9U0 A0A1M7FIB4 A0A1Q9KSB6 A0A1V6LIV0 A0A1V9VY08 A0A226R8T2 A0A229MP98 A0A229MVV4 A0A242W707 A0A242WG88 A0A242X4S8 A0A242XIC6 A0A242XZ02 A0A242YD16 A0A242YW43 A0A242ZQ04 A0A243A3I2 A0A243AQV6 A0A243AVE9 A0A243C9E2 A0A243CMW1 A0A243DC21 A0A243DPS7 A0A243EJQ3 A0A243ENT9 A0A243EVR7 A0A243FHB6 A0A243GDA5 A0A243HGM1 A0A243I5N9 A0A243IFV5 A0A243J844 A0A243JXL5 A0A243JZV5 A0A243KC67 A0A243LPB3 A0A243MEQ8 A0A243MSU3 A0A243N2K5 A0A243NM48 A0A246PPP8 A0A246UDM0 A0A2A7ECX2 A0A2A9HNC7 A0A2B4FLU3 A0A2B4P2G0 A0A2G6QEB9 A0A2H3QIM8 A0A2K1RPD8 A0RJI0 A9VJP4 B3ZCV7 B7HF95 B7HRM0 B7IJX9 B7JR88 B9J081 C2X320 C3DR59 D8GY96 F0PJG1 J3ZWH3 J7TL05 J7V8D9 J7WD13 J7ZC32 J8B3H1 J8B6N0 J8DPH4 J8E8Q5 J8F7F2 J8G811 J8GXT2 J8IFN8 J8IP80 J8IVC8 J8J0L1 J8JHL0 J8JML4 J8KCQ2 J8L117 J8L6K2 J8MH63 J8N4A1 J8PAD8 J8PDA3 J8QXF6 J8R159 J8XDN4 J8YPP0 J8ZXL4 J9BZY9 M1QSZ0 N1LY47 Q633L5 Q6HCU9 Q72ZF6 Q817G9 Q81L09 R8CG93 R8D159 R8D253 R8E309 R8EK72 R8FCE0 R8G3F2 R8GAG4 R8GQW6 R8H6S8 R8HFG7 R8IYU0 R8K0Y7 R8L6Z0 R8LH24 R8ML70 R8NUY4 R8Q1K6 R8RJW0 R8TDG3 R8XSZ0 S3IMY4 V5MHF6 W4DQN6
gi|301056087|ref|YP_003794298.1| gi|218899734|ref|YP_002448145.1| gi|225866558|ref|YP_002751936.1| gi|229600230|ref|YP_002868860.1| gi|49478812|ref|YP_038627.1| APC26153 gi|218905808|ref|YP_002453642.1| gi|227817365|ref|YP_002817374.1| gi|402555292|ref|YP_006596563.1| gi|384188655|ref|YP_005574551.1| gi|163942315|ref|YP_001647199.1| gi|434377735|ref|YP_006612379.1| gi|296505053|ref|YP_003666753.1| gi|118479729|ref|YP_896880.1| gi|52140928|ref|YP_085902.1| gi|42783758|ref|NP_981005.1| gi|49187472|ref|YP_030724.1| gi|217962060|ref|YP_002340630.1| gi|47530122|ref|YP_021471.1| gi|30022657|ref|NP_834288.1| gi|222098043|ref|YP_002532100.1| gi|402563903|ref|YP_006606627.1| 198094.BA_4825 222523.BCE_4712 226900.BC4582 260799.BAS4477 261594.GBAA4825 281309.BT9727_4312 288681.BCZK4323 315730.BcerKBAB4_4412 361100.BCQ_4385 405531.BCG9842_B0547 405532.BCB4264_A4691 405534.BCAH187_A4706 405535.BCAH820_4696 412694.BALH_4165 568206.BAMEG_4856 572264.BCA_4691 592021.BAA_4836 gi|375286575|ref|YP_005107014.1| gi|30264651|ref|NP_847028.1| NP_834288.1.86172 NP_847028.1.87267 WP_000380455.1.100059 WP_000380455.1.100082 WP_000380455.1.100095 WP_000380455.1.100214 WP_000380455.1.100215 WP_000380455.1.100231 WP_000380455.1.100241 WP_000380455.1.100409 WP_000380455.1.100479 WP_000380455.1.100497 WP_000380455.1.10055 WP_000380455.1.100595 WP_000380455.1.100621 WP_000380455.1.100646 WP_000380455.1.100649 WP_000380455.1.100684 WP_000380455.1.10069 WP_000380455.1.100771 WP_000380455.1.100873 WP_000380455.1.100912 WP_000380455.1.101140 WP_000380455.1.101309 WP_000380455.1.101550 WP_000380455.1.101720 WP_000380455.1.101838 WP_000380455.1.101843 WP_000380455.1.101931 WP_000380455.1.10208 WP_000380455.1.10584 WP_000380455.1.10745 WP_000380455.1.10762 WP_000380455.1.10775 WP_000380455.1.11044 WP_000380455.1.11060 WP_000380455.1.11380 WP_000380455.1.11387 WP_000380455.1.11427 WP_000380455.1.11442 WP_000380455.1.11521 WP_000380455.1.11609 WP_000380455.1.1228 WP_000380455.1.12289 WP_000380455.1.12553 WP_000380455.1.12751 WP_000380455.1.12935 WP_000380455.1.13024 WP_000380455.1.13113 WP_000380455.1.13115 WP_000380455.1.13221 WP_000380455.1.13233 WP_000380455.1.13269 WP_000380455.1.13279 WP_000380455.1.13299 WP_000380455.1.13424 WP_000380455.1.13498 WP_000380455.1.1354 WP_000380455.1.13820 WP_000380455.1.13975 WP_000380455.1.14006 WP_000380455.1.14039 WP_000380455.1.14084 WP_000380455.1.14117 WP_000380455.1.14174 WP_000380455.1.14176 WP_000380455.1.14721 WP_000380455.1.14855 WP_000380455.1.14882 WP_000380455.1.15163 WP_000380455.1.15502 WP_000380455.1.15569 WP_000380455.1.16013 WP_000380455.1.16156 WP_000380455.1.16170 WP_000380455.1.16199 WP_000380455.1.16355 WP_000380455.1.16997 WP_000380455.1.17146 WP_000380455.1.17265 WP_000380455.1.17374 WP_000380455.1.17408 WP_000380455.1.17424 WP_000380455.1.17797 WP_000380455.1.17899 WP_000380455.1.17927 WP_000380455.1.17940 WP_000380455.1.1809 WP_000380455.1.1850 WP_000380455.1.18840 WP_000380455.1.18914 WP_000380455.1.18976 WP_000380455.1.1907 WP_000380455.1.19173 WP_000380455.1.19258 WP_000380455.1.19435 WP_000380455.1.19438 WP_000380455.1.19445 WP_000380455.1.195 WP_000380455.1.20051 WP_000380455.1.20208 WP_000380455.1.20390 WP_000380455.1.20643 WP_000380455.1.20651 WP_000380455.1.20665 WP_000380455.1.20680 WP_000380455.1.20687 WP_000380455.1.20865 WP_000380455.1.20881 WP_000380455.1.20973 WP_000380455.1.21021 WP_000380455.1.21055 WP_000380455.1.21172 WP_000380455.1.21258 WP_000380455.1.21643 WP_000380455.1.21695 WP_000380455.1.21776 WP_000380455.1.22084 WP_000380455.1.22152 WP_000380455.1.22507 WP_000380455.1.2251 WP_000380455.1.226 WP_000380455.1.22699 WP_000380455.1.22865 WP_000380455.1.22991 WP_000380455.1.23100 WP_000380455.1.23110 WP_000380455.1.23136 WP_000380455.1.23200 WP_000380455.1.23245 WP_000380455.1.23297 WP_000380455.1.23360 WP_000380455.1.23427 WP_000380455.1.23540 WP_000380455.1.23615 WP_000380455.1.23652 WP_000380455.1.23873 WP_000380455.1.2407 WP_000380455.1.24182 WP_000380455.1.24184 WP_000380455.1.2419 WP_000380455.1.24334 WP_000380455.1.24338 WP_000380455.1.24377 WP_000380455.1.24556 WP_000380455.1.24608 WP_000380455.1.24676 WP_000380455.1.24680 WP_000380455.1.24709 WP_000380455.1.24759 WP_000380455.1.24792 WP_000380455.1.24969 WP_000380455.1.24992 WP_000380455.1.2521 WP_000380455.1.25290 WP_000380455.1.25316 WP_000380455.1.25505 WP_000380455.1.25572 WP_000380455.1.25599 WP_000380455.1.2569 WP_000380455.1.25716 WP_000380455.1.25752 WP_000380455.1.25757 WP_000380455.1.26000 WP_000380455.1.2618 WP_000380455.1.26450 WP_000380455.1.26459 WP_000380455.1.26513 WP_000380455.1.26637 WP_000380455.1.26665 WP_000380455.1.26721 WP_000380455.1.26826 WP_000380455.1.26847 WP_000380455.1.27138 WP_000380455.1.27140 WP_000380455.1.27334 WP_000380455.1.27446 WP_000380455.1.27644 WP_000380455.1.27729 WP_000380455.1.27732 WP_000380455.1.27987 WP_000380455.1.28299 WP_000380455.1.28599 WP_000380455.1.28729 WP_000380455.1.28913 WP_000380455.1.2902 WP_000380455.1.2904 WP_000380455.1.29101 WP_000380455.1.29209 WP_000380455.1.29451 WP_000380455.1.29766 WP_000380455.1.29787 WP_000380455.1.29804 WP_000380455.1.30061 WP_000380455.1.30091 WP_000380455.1.30110 WP_000380455.1.30144 WP_000380455.1.30216 WP_000380455.1.3026 WP_000380455.1.30317 WP_000380455.1.30336 WP_000380455.1.30788 WP_000380455.1.31050 WP_000380455.1.31221 WP_000380455.1.3130 WP_000380455.1.31387 WP_000380455.1.31490 WP_000380455.1.31503 WP_000380455.1.31685 WP_000380455.1.3180 WP_000380455.1.3196 WP_000380455.1.3236 WP_000380455.1.3249 WP_000380455.1.32522 WP_000380455.1.32576 WP_000380455.1.32784 WP_000380455.1.32927 WP_000380455.1.33045 WP_000380455.1.33061 WP_000380455.1.33175 WP_000380455.1.3318 WP_000380455.1.33201 WP_000380455.1.33338 WP_000380455.1.33367 WP_000380455.1.33536 WP_000380455.1.33717 WP_000380455.1.33740 WP_000380455.1.33790 WP_000380455.1.33828 WP_000380455.1.33876 WP_000380455.1.34061 WP_000380455.1.34125 WP_000380455.1.34158 WP_000380455.1.34537 WP_000380455.1.34646 WP_000380455.1.35026 WP_000380455.1.35095 WP_000380455.1.35153 WP_000380455.1.35255 WP_000380455.1.3546 WP_000380455.1.35518 WP_000380455.1.3561 WP_000380455.1.35684 WP_000380455.1.35769 WP_000380455.1.35886 WP_000380455.1.3612 WP_000380455.1.3615 WP_000380455.1.36221 WP_000380455.1.36226 WP_000380455.1.36279 WP_000380455.1.36305 WP_000380455.1.36763 WP_000380455.1.3699 WP_000380455.1.37019 WP_000380455.1.37027 WP_000380455.1.37093 WP_000380455.1.37384 WP_000380455.1.37626 WP_000380455.1.37635 WP_000380455.1.37649 WP_000380455.1.37661 WP_000380455.1.37801 WP_000380455.1.3798 WP_000380455.1.37990 WP_000380455.1.38036 WP_000380455.1.38270 WP_000380455.1.38325 WP_000380455.1.38345 WP_000380455.1.38425 WP_000380455.1.38517 WP_000380455.1.38645 WP_000380455.1.39001 WP_000380455.1.3925 WP_000380455.1.39255 WP_000380455.1.39317 WP_000380455.1.39538 WP_000380455.1.39781 WP_000380455.1.39896 WP_000380455.1.39957 WP_000380455.1.40034 WP_000380455.1.4039 WP_000380455.1.40550 WP_000380455.1.40818 WP_000380455.1.40839 WP_000380455.1.41083 WP_000380455.1.41090 WP_000380455.1.41165 WP_000380455.1.41365 WP_000380455.1.41464 WP_000380455.1.41518 WP_000380455.1.41675 WP_000380455.1.41729 WP_000380455.1.41976 WP_000380455.1.42165 WP_000380455.1.42182 WP_000380455.1.42217 WP_000380455.1.42237 WP_000380455.1.42272 WP_000380455.1.42485 WP_000380455.1.42747 WP_000380455.1.42941 WP_000380455.1.43104 WP_000380455.1.43434 WP_000380455.1.43533 WP_000380455.1.4354 WP_000380455.1.4355 WP_000380455.1.43762 WP_000380455.1.4439 WP_000380455.1.44449 WP_000380455.1.44463 WP_000380455.1.44483 WP_000380455.1.4453 WP_000380455.1.44956 WP_000380455.1.4496 WP_000380455.1.45089 WP_000380455.1.45305 WP_000380455.1.45317 WP_000380455.1.45385 WP_000380455.1.45533 WP_000380455.1.45835 WP_000380455.1.45919 WP_000380455.1.46157 WP_000380455.1.46236 WP_000380455.1.46244 WP_000380455.1.46326 WP_000380455.1.46349 WP_000380455.1.46476 WP_000380455.1.4649 WP_000380455.1.46524 WP_000380455.1.46549 WP_000380455.1.46586 WP_000380455.1.46699 WP_000380455.1.46746 WP_000380455.1.46864 WP_000380455.1.47095 WP_000380455.1.47097 WP_000380455.1.47145 WP_000380455.1.473 WP_000380455.1.474 WP_000380455.1.47437 WP_000380455.1.47441 WP_000380455.1.4763 WP_000380455.1.47674 WP_000380455.1.47798 WP_000380455.1.47936 WP_000380455.1.47957 WP_000380455.1.47975 WP_000380455.1.48010 WP_000380455.1.48164 WP_000380455.1.48311 WP_000380455.1.48599 WP_000380455.1.4865 WP_000380455.1.48759 WP_000380455.1.49056 WP_000380455.1.49428 WP_000380455.1.4964 WP_000380455.1.49802 WP_000380455.1.49831 WP_000380455.1.499 WP_000380455.1.49911 WP_000380455.1.50042 WP_000380455.1.5025 WP_000380455.1.50316 WP_000380455.1.50350 WP_000380455.1.50411 WP_000380455.1.50416 WP_000380455.1.50487 WP_000380455.1.50514 WP_000380455.1.50770 WP_000380455.1.51072 WP_000380455.1.51087 WP_000380455.1.51099 WP_000380455.1.51167 WP_000380455.1.51335 WP_000380455.1.51556 WP_000380455.1.51656 WP_000380455.1.51749 WP_000380455.1.52284 WP_000380455.1.52494 WP_000380455.1.52532 WP_000380455.1.52756 WP_000380455.1.52794 WP_000380455.1.52845 WP_000380455.1.52932 WP_000380455.1.53137 WP_000380455.1.53493 WP_000380455.1.53621 WP_000380455.1.53672 WP_000380455.1.53683 WP_000380455.1.53879 WP_000380455.1.53916 WP_000380455.1.54007 WP_000380455.1.54116 WP_000380455.1.54117 WP_000380455.1.54189 WP_000380455.1.54240 WP_000380455.1.54419 WP_000380455.1.54547 WP_000380455.1.54736 WP_000380455.1.54775 WP_000380455.1.54782 WP_000380455.1.55057 WP_000380455.1.55116 WP_000380455.1.55788 WP_000380455.1.55811 WP_000380455.1.55893 WP_000380455.1.55958 WP_000380455.1.55968 WP_000380455.1.56042 WP_000380455.1.56055 WP_000380455.1.56176 WP_000380455.1.56270 WP_000380455.1.5628 WP_000380455.1.56318 WP_000380455.1.56320 WP_000380455.1.56549 WP_000380455.1.56580 WP_000380455.1.56959 WP_000380455.1.57105 WP_000380455.1.57203 WP_000380455.1.57245 WP_000380455.1.57561 WP_000380455.1.57565 WP_000380455.1.57732 WP_000380455.1.57815 WP_000380455.1.57859 WP_000380455.1.58037 WP_000380455.1.58160 WP_000380455.1.58328 WP_000380455.1.5841 WP_000380455.1.58712 WP_000380455.1.58814 WP_000380455.1.58822 WP_000380455.1.5895 WP_000380455.1.59016 WP_000380455.1.59052 WP_000380455.1.59058 WP_000380455.1.59075 WP_000380455.1.59095 WP_000380455.1.59173 WP_000380455.1.59310 WP_000380455.1.59384 WP_000380455.1.59575 WP_000380455.1.59978 WP_000380455.1.59997 WP_000380455.1.6 WP_000380455.1.60012 WP_000380455.1.60153 WP_000380455.1.60236 WP_000380455.1.60255 WP_000380455.1.60274 WP_000380455.1.60334 WP_000380455.1.60402 WP_000380455.1.60526 WP_000380455.1.60781 WP_000380455.1.60841 WP_000380455.1.61126 WP_000380455.1.61213 WP_000380455.1.61231 WP_000380455.1.61481 WP_000380455.1.61799 WP_000380455.1.61820 WP_000380455.1.61919 WP_000380455.1.61944 WP_000380455.1.62107 WP_000380455.1.62277 WP_000380455.1.62300 WP_000380455.1.6241 WP_000380455.1.62918 WP_000380455.1.62978 WP_000380455.1.6304 WP_000380455.1.63137 WP_000380455.1.6340 WP_000380455.1.63476 WP_000380455.1.63560 WP_000380455.1.63611 WP_000380455.1.63789 WP_000380455.1.63902 WP_000380455.1.6426 WP_000380455.1.64282 WP_000380455.1.64377 WP_000380455.1.64421 WP_000380455.1.64491 WP_000380455.1.64566 WP_000380455.1.64568 WP_000380455.1.64615 WP_000380455.1.64666 WP_000380455.1.64706 WP_000380455.1.64770 WP_000380455.1.65515 WP_000380455.1.65665 WP_000380455.1.65758 WP_000380455.1.65803 WP_000380455.1.65983 WP_000380455.1.66331 WP_000380455.1.66357 WP_000380455.1.66471 WP_000380455.1.66535 WP_000380455.1.66932 WP_000380455.1.67001 WP_000380455.1.67108 WP_000380455.1.6716 WP_000380455.1.67239 WP_000380455.1.67283 WP_000380455.1.6753 WP_000380455.1.67742 WP_000380455.1.67873 WP_000380455.1.67912 WP_000380455.1.68186 WP_000380455.1.6846 WP_000380455.1.68550 WP_000380455.1.68562 WP_000380455.1.68607 WP_000380455.1.68668 WP_000380455.1.69203 WP_000380455.1.69323 WP_000380455.1.69347 WP_000380455.1.69703 WP_000380455.1.69822 WP_000380455.1.69894 WP_000380455.1.6996 WP_000380455.1.69970 WP_000380455.1.70018 WP_000380455.1.70065 WP_000380455.1.70108 WP_000380455.1.70209 WP_000380455.1.70645 WP_000380455.1.70667 WP_000380455.1.7096 WP_000380455.1.70996 WP_000380455.1.71114 WP_000380455.1.71142 WP_000380455.1.71247 WP_000380455.1.71441 WP_000380455.1.71648 WP_000380455.1.71652 WP_000380455.1.71895 WP_000380455.1.71953 WP_000380455.1.72294 WP_000380455.1.72514 WP_000380455.1.72554 WP_000380455.1.72704 WP_000380455.1.72752 WP_000380455.1.72824 WP_000380455.1.72867 WP_000380455.1.72912 WP_000380455.1.73166 WP_000380455.1.73325 WP_000380455.1.73329 WP_000380455.1.73396 WP_000380455.1.73457 WP_000380455.1.73594 WP_000380455.1.73638 WP_000380455.1.73790 WP_000380455.1.73952 WP_000380455.1.7398 WP_000380455.1.74226 WP_000380455.1.74337 WP_000380455.1.74538 WP_000380455.1.74651 WP_000380455.1.74863 WP_000380455.1.74901 WP_000380455.1.75292 WP_000380455.1.75300 WP_000380455.1.7534 WP_000380455.1.75358 WP_000380455.1.75374 WP_000380455.1.7544 WP_000380455.1.7545 WP_000380455.1.75499 WP_000380455.1.75554 WP_000380455.1.75870 WP_000380455.1.75891 WP_000380455.1.75915 WP_000380455.1.7593 WP_000380455.1.75942 WP_000380455.1.76086 WP_000380455.1.76125 WP_000380455.1.76155 WP_000380455.1.76342 WP_000380455.1.76783 WP_000380455.1.76804 WP_000380455.1.76817 WP_000380455.1.76902 WP_000380455.1.77370 WP_000380455.1.77402 WP_000380455.1.77576 WP_000380455.1.77668 WP_000380455.1.77690 WP_000380455.1.77824 WP_000380455.1.77902 WP_000380455.1.77968 WP_000380455.1.782 WP_000380455.1.78264 WP_000380455.1.7856 WP_000380455.1.78644 WP_000380455.1.79043 WP_000380455.1.79250 WP_000380455.1.79252 WP_000380455.1.79293 WP_000380455.1.79315 WP_000380455.1.79549 WP_000380455.1.79584 WP_000380455.1.79658 WP_000380455.1.79687 WP_000380455.1.80126 WP_000380455.1.80239 WP_000380455.1.80439 WP_000380455.1.80571 WP_000380455.1.80622 WP_000380455.1.80649 WP_000380455.1.80695 WP_000380455.1.80955 WP_000380455.1.80964 WP_000380455.1.81088 WP_000380455.1.81198 WP_000380455.1.81570 WP_000380455.1.81773 WP_000380455.1.81799 WP_000380455.1.82289 WP_000380455.1.82421 WP_000380455.1.82533 WP_000380455.1.82566 WP_000380455.1.82832 WP_000380455.1.8290 WP_000380455.1.82986 WP_000380455.1.83070 WP_000380455.1.83206 WP_000380455.1.83228 WP_000380455.1.8365 WP_000380455.1.83666 WP_000380455.1.83938 WP_000380455.1.83951 WP_000380455.1.84045 WP_000380455.1.84323 WP_000380455.1.84337 WP_000380455.1.84422 WP_000380455.1.8450 WP_000380455.1.84520 WP_000380455.1.84541 WP_000380455.1.84599 WP_000380455.1.84614 WP_000380455.1.84775 WP_000380455.1.85012 WP_000380455.1.85187 WP_000380455.1.85348 WP_000380455.1.85592 WP_000380455.1.85667 WP_000380455.1.85689 WP_000380455.1.8577 WP_000380455.1.85901 WP_000380455.1.86041 WP_000380455.1.86082 WP_000380455.1.86119 WP_000380455.1.86140 WP_000380455.1.86239 WP_000380455.1.86288 WP_000380455.1.86619 WP_000380455.1.86637 WP_000380455.1.86763 WP_000380455.1.86789 WP_000380455.1.869 WP_000380455.1.8698 WP_000380455.1.87416 WP_000380455.1.8759 WP_000380455.1.87627 WP_000380455.1.87649 WP_000380455.1.87705 WP_000380455.1.87768 WP_000380455.1.87873 WP_000380455.1.87960 WP_000380455.1.88154 WP_000380455.1.88200 WP_000380455.1.8825 WP_000380455.1.88269 WP_000380455.1.88431 WP_000380455.1.8907 WP_000380455.1.89145 WP_000380455.1.8923 WP_000380455.1.89263 WP_000380455.1.89325 WP_000380455.1.89460 WP_000380455.1.89564 WP_000380455.1.89675 WP_000380455.1.89698 WP_000380455.1.89704 WP_000380455.1.89932 WP_000380455.1.90155 WP_000380455.1.90187 WP_000380455.1.90254 WP_000380455.1.90352 WP_000380455.1.90452 WP_000380455.1.90596 WP_000380455.1.90671 WP_000380455.1.90791 WP_000380455.1.90883 WP_000380455.1.91020 WP_000380455.1.91080 WP_000380455.1.91367 WP_000380455.1.91404 WP_000380455.1.91569 WP_000380455.1.91615 WP_000380455.1.9186 WP_000380455.1.92347 WP_000380455.1.92555 WP_000380455.1.92586 WP_000380455.1.92620 WP_000380455.1.92686 WP_000380455.1.9269 WP_000380455.1.93271 WP_000380455.1.93290 WP_000380455.1.93582 WP_000380455.1.93744 WP_000380455.1.93838 WP_000380455.1.93893 WP_000380455.1.93904 WP_000380455.1.93927 WP_000380455.1.93932 WP_000380455.1.94237 WP_000380455.1.94270 WP_000380455.1.94322 WP_000380455.1.94373 WP_000380455.1.94784 WP_000380455.1.94914 WP_000380455.1.95308 WP_000380455.1.9533 WP_000380455.1.95457 WP_000380455.1.95484 WP_000380455.1.95576 WP_000380455.1.95786 WP_000380455.1.96272 WP_000380455.1.96287 WP_000380455.1.96356 WP_000380455.1.96437 WP_000380455.1.96934 WP_000380455.1.9700 WP_000380455.1.9703 WP_000380455.1.97149 WP_000380455.1.97262 WP_000380455.1.97327 WP_000380455.1.97561 WP_000380455.1.97617 WP_000380455.1.97670 WP_000380455.1.97781 WP_000380455.1.97816 WP_000380455.1.97821 WP_000380455.1.97830 WP_000380455.1.97842 WP_000380455.1.97861 WP_000380455.1.97993 WP_000380455.1.98053 WP_000380455.1.98216 WP_000380455.1.98315 WP_000380455.1.98519 WP_000380455.1.98557 WP_000380455.1.98571 WP_000380455.1.98604 WP_000380455.1.99044 WP_000380455.1.99212 WP_000380455.1.99266 WP_000380455.1.99445 WP_000380455.1.99454 WP_000380455.1.99485 WP_000380455.1.99558 WP_000380455.1.99908 WP_000380455.1.99994 YP_030724.1.16718 YP_038627.1.62562 gi|376268509|ref|YP_005121221.1| gi|384182390|ref|YP_005568152.1| gi|410676978|ref|YP_006929349.1| gi|558683242|ref|YP_008821371.1| gi|218235706|ref|YP_002369377.1| gi|557621378|ref|YP_008782509.1| gi|452201051|ref|YP_007481132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]