SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942345|ref|YP_001647229.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942345|ref|YP_001647229.1|
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.9e-42
Family Hypothetical protein TM0207 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942345|ref|YP_001647229.1|
Sequence length 228
Comment metal-dependent hydrolase [Bacillus weihenstephanensis KBAB4]
Sequence
MMRVSYHGHSVVKIETNGKVILIDPFLTGNPKTDLKAEDVKVDAIILSHGHGDHVGDTVA
LAKNNNAVVVAPFELATFLGWQGVNTHPMHIGGSHEFDFGKVKFTQAFHGSSYIDEENKT
ITYTGMPAGILFTAEEKTVYHAGDTALFSDMKLIGELNNIDVAFLPIGDNFTMGPEDAVL
AAKWIEAKTVVPMHYNTFPVIEQDPYQFVEKLQNCTGKVLEAGESITL
Download sequence
Identical sequences A9VJS4
gi|163942345|ref|YP_001647229.1| 315730.BcerKBAB4_4442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]