SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942362|ref|YP_001647246.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942362|ref|YP_001647246.1|
Domain Number 1 Region: 170-397
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 1.83e-95
Family Argininosuccinate synthetase, C-terminal domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 1-170
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.97e-47
Family N-type ATP pyrophosphatases 0.00000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942362|ref|YP_001647246.1|
Sequence length 401
Comment argininosuccinate synthase [Bacillus weihenstephanensis KBAB4]
Sequence
MEKKKVVLAYSGGLDTSVAIKWLQEKNYDIIALCLDLGEGKDLAFVKEKALSVGAIKSYM
IDVQEEYANEYALIAMQAHTLYEGKYPLVSALSRPLIAKKLVEIAEQEGASAVAHGCTGK
GNDQVRFEVSIQALNPYLEVIAPVREWKWSREEEIAYAKENDIPIPINLDSPFSIDQNLW
GRSNECGILEDPWAAPPEEAYEMTLALEDTPNKPEFVEIGFEAGVPTTLNGTAYSLSELI
KTLNALAGKHGVGRIDHVENRLVGIKSREVYECPAAMTLITAHKELEDLTLVKEVAHFKP
MIEQKLTELIYNGLWFSPLKQALNAFLQETQKNVTGTVRVKLFKGHAIVEGRKSEYSLYD
EKLATYTAQDEFNHDAAVGFISLFGLPTKVYSQVNQKKVEA
Download sequence
Identical sequences A0A0D6SMZ3 A9VKE1 J8FKJ9 R8D114 R8H6M6 R8MK92
315730.BcerKBAB4_4460 gi|163942362|ref|YP_001647246.1| WP_002129394.1.10033 WP_002129394.1.17940 WP_002129394.1.37635 WP_002129394.1.39317 WP_002129394.1.4354 WP_002129394.1.59016 WP_002129394.1.60236 WP_002129394.1.6426 WP_002129394.1.72867 WP_002129394.1.75292 WP_002129394.1.76817 WP_002129394.1.82832 WP_002129394.1.84520 WP_002129394.1.85187 WP_002129394.1.86789 WP_002129394.1.87416 WP_002129394.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]