SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942407|ref|YP_001647291.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942407|ref|YP_001647291.1|
Domain Number 1 Region: 62-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.74e-90
Family L-arabinose binding protein-like 0.00000000458
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.44e-20
Family GalR/LacI-like bacterial regulator 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163942407|ref|YP_001647291.1|
Sequence length 332
Comment global transcriptional regulator, catabolite control protein A [Bacillus weihenstephanensis KBAB4]
Sequence
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKT
TTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGI
VFMGEDITDIHVEEFKKSPVPIVLAASFDEQNETSSVNIDYTQAAYDAMKHFIEQGHKRI
GFVSGPFINKAGSAKKLQGYKKALEEAGISYDENLIIDGDYTYDSGIEAFERLWGMDEKP
TAIFVSSDEMALGVIHAAQDAGLNVPTDIEVLGFDNTRLALMVRPQLSTVVQPMYDIGAV
AMRLLTKYMNKEKVEDHSVILPHRIQFRDSTK
Download sequence
Identical sequences A0A084IVW8 A0A150C3X2 A0A1I5X3I5 A9VKI6 C2SRD3 C2Y0D9 J7VK05 J8CTH0 J8IFG3 J8IL48 J8NWT2 J8P705 J8PRJ5 J9C076 R8D0M4 R8D2G3 R8EKC5 R8H6K1 R8MKH5 W4DPS1
gi|163942407|ref|YP_001647291.1| 315730.BcerKBAB4_4506 WP_002034370.1.10033 WP_002034370.1.100646 WP_002034370.1.100649 WP_002034370.1.11324 WP_002034370.1.17940 WP_002034370.1.20051 WP_002034370.1.20881 WP_002034370.1.21695 WP_002034370.1.27729 WP_002034370.1.27732 WP_002034370.1.28299 WP_002034370.1.2902 WP_002034370.1.2904 WP_002034370.1.30061 WP_002034370.1.31050 WP_002034370.1.35095 WP_002034370.1.36226 WP_002034370.1.37635 WP_002034370.1.37801 WP_002034370.1.38645 WP_002034370.1.39255 WP_002034370.1.39317 WP_002034370.1.39896 WP_002034370.1.4354 WP_002034370.1.4496 WP_002034370.1.45835 WP_002034370.1.46157 WP_002034370.1.47674 WP_002034370.1.47957 WP_002034370.1.50411 WP_002034370.1.52845 WP_002034370.1.54007 WP_002034370.1.57105 WP_002034370.1.59016 WP_002034370.1.60236 WP_002034370.1.63476 WP_002034370.1.6426 WP_002034370.1.68186 WP_002034370.1.68668 WP_002034370.1.72867 WP_002034370.1.75292 WP_002034370.1.76817 WP_002034370.1.79293 WP_002034370.1.82832 WP_002034370.1.8290 WP_002034370.1.85012 WP_002034370.1.85187 WP_002034370.1.86789 WP_002034370.1.87416 WP_002034370.1.93582 WP_002034370.1.99558 WP_002034370.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]