SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942470|ref|YP_001647354.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942470|ref|YP_001647354.1|
Domain Number 1 Region: 2-224,411-625
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.02e-145
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000506
Further Details:      
 
Domain Number 2 Region: 224-407
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.47e-53
Family ValRS/IleRS/LeuRS editing domain 0.00000157
Further Details:      
 
Domain Number 3 Region: 618-801
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.55e-43
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942470|ref|YP_001647354.1|
Sequence length 802
Comment leucyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
Sequence
MSFNHQEIEKKWQGHWEENKTFRTPDETEKPKFYALDMFPYPSGAGLHVGHPEGYTATDI
LSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQIKALGFSYDW
DREVNTTDPTYYKWTQWIFLKLFEKGLAYVDEVPVNWCPALGTVLANEEIIDGKSERGGH
PVERRPMRQWMLKITAYGDRLLEDLDELNWPESLKDMQRNWIGRSEGAEVHFNIDGTDEK
FTVFTTRPDTLFGASYCVLAPEHALVANITIPEQKEAVEAYINSVKMKSDLERTELAKEK
TGVFTGAYAVNPVNGEKLPIWIADYVLATYGTGAVMAVPAHDERDYEFASTFNLPMKEVV
KGGDISKEAYTGDGAHVNSAFLDGLNKEKAIVKMIEWLEVTSAGNQKVTYRLRDWLFSRQ
RYWGEPIPVIHWEDGTMTAVKEEELPLVLPKTENIRPSGTGESPLANIEEWVNVVDPETG
KKGRRETNTMPQWAGSCWYYLRYIDPNNSEALVDPEKVKQWLPVDIYIGGAEHAVLHLLY
ARFWHKVLYDIGVVPTKEPFQQLFNQGMILGENNEKMSKSKGNVVNPDDIVASHGADTLR
LYEMFMGPLDASIAWSENGLDGARRFLDRVWRLFIQENGELSEKITDAPNKDLEKAYHQT
VKKVTEDYAELRFNTAISQMMVFINDAYKAETLPKEYVEGFVKMIAPVAPHIGEELWNKL
GYSETITYASWPTFDESKLVEDEVEIVVQIMGKVRTKLTMSKDASKEEMEQLALEAIKEQ
IEGKTVRKVIVVPGKLVNVVAN
Download sequence
Identical sequences A9VLA2
gi|163942470|ref|YP_001647354.1| WP_012261857.1.99908 315730.BcerKBAB4_4570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]