SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942504|ref|YP_001647388.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942504|ref|YP_001647388.1|
Domain Number 1 Region: 5-512
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 7.2e-217
Family Heme-dependent catalases 0.0000000000265
Further Details:      
 
Domain Number 2 Region: 533-673
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00000000000126
Family Catalase, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163942504|ref|YP_001647388.1|
Sequence length 675
Comment catalase [Bacillus weihenstephanensis KBAB4]
Sequence
MDGRENKKIEQLQSFTKNNEGKEMTTNTGVKISNDENSLTAGDRGPTLLEDFLMREKLAH
FDRERIPERVVHARGYGAHGVFELYDSLEDLTMAHFLQDPSKKTPIFIRFSEVAGSKGAN
ETNRDVRGFAVKFYTEEGNFDLVGNNIPIFFIQDGIKFPDLIHALKPEPHNEIPQGQTAH
DTFWDFIANNQESAAMMMWIMSDRAIPRSFRMMQGFGVHTFRLVNKHGKSRFVKFHWKPK
LGVHSLIWDEAQKLGGADPDYHRRDLWENINAGNYPEYELGVQILEEEDEFKYDFDILDA
TKIWPEEDFPVKIIGKMTLNRNVDNVFAETEQVALHPGSIVRGIDFTNDPLLQGRLFSYT
DTQLARVGTNYQELPINRPVCPFHNNQRDGASKYIIDKGKVAYHNNSLANNSPFTVPGTK
GGFVTYPSTVSGHKTRETAASFKDHFSQARLFWNSMSHVERIHIMQAFSFELGKVKSKSV
RQQVVGMIGHISTELATLVAEAVGATVPNVQESNVTKSSPALSMEHTTFSPNTLRVGVIV
ANGYDGQNAQYIINQFKQAGLQPVIISERLGFVQGSQNGQWEVNDTFLTGSPLLYDGLLL
IGGNINDHFLNKASSFVVESYNHFKPIGAFQNGTTIVQSLNIEGKPGVITEQNPTLLANE
FIQAMTKQRFWERAY
Download sequence
Identical sequences A9VLD6
gi|163942504|ref|YP_001647388.1| WP_012261864.1.99908 315730.BcerKBAB4_4605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]