SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942541|ref|YP_001647425.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942541|ref|YP_001647425.1|
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000000000000058
Family FeoA-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163942541|ref|YP_001647425.1|
Sequence length 75
Comment FeoA family protein [Bacillus weihenstephanensis KBAB4]
Sequence
MSLVDIKIGEKVLVKSIQSLDQLLKRRLAAFGLAEGSELRLKQKAMFKGPCTLECRGQLI
SIRHCDAKMIKVELA
Download sequence
Identical sequences A0A023PBQ5 A0A063CP77 A0A084IWY2 A0A0D0RS40 A0A0D0RW21 A0A0E8TE99 A0A0F6FRW4 A0A0F6JDZ5 A0A0G3E7N1 A0A0G4CTH2 A0A0K0SEY2 A0A0W7Y890 A0A135WSX1 A0A193CZ70 A0A1C9C0F5 A0A1G1UU43 A0A1H4GTV1 A0A1I4ECR6 A0A1M6MZ99 A0A1M7KA54 A0A1Q9KSA0 A0A1V6LI50 A0A1W2GD63 A0A229M892 A0A229MVU3 A0A242X1S9 A0A242YN58 A0A242ZIU4 A0A242ZQN1 A0A243AKS1 A0A243BRL6 A0A243BZ31 A0A243DIZ4 A0A243DP54 A0A243ESX2 A0A243EYY9 A0A243FKV8 A0A243GE17 A0A243HJA1 A0A243JAT4 A0A243KDW8 A0A243L4T4 A0A243NMS4 A0A2A7XSG5 A0A2A9AFR0 A0A2A9HS30 A0A2B4NXU5 A0A2C9YFC6 A0A2C9ZAA3 A0A2I0REH5 A9VM24 B5UP14 B7H9I2 B7HTR9 B9J2A6 C2N847 C2P5D6 C2PLV8 C2REU5 C2SAF4 C2SRR9 C2T7K5 C2UKP2 C2V249 C2VIH1 C2WUB5 C2XIA8 C2Y0S9 C3C9H6 F0PM46 G9Q067 J7Z4C0 J8CPW1 J8IV13 J8J168 J8J2Y7 J8LDR9 J8M9G9 J8MN91 J8N226 J8NQU0 J8NSB3 J8YQU2 K0FMC8 M1QTP5 N1LKR5 Q816M2 R8D128 R8D1V0 R8E4R6 R8EBI2 R8FBN4 R8G4J3 R8GA18 R8GS12 R8HA87 R8JZV8 R8L6J5 R8LFE0 R8MIV3 R8PFF0 R8TCC1 S3IRT9 V5MGV2 W4DPF9 W8YI98
gi|557621609|ref|YP_008782740.1| gi|449091779|ref|YP_007424220.1| gi|407707331|ref|YP_006830916.1| gi|217962300|ref|YP_002340870.1| gi|384182629|ref|YP_005568391.1| NP_834507.1.86172 WP_000060512.1.100082 WP_000060512.1.100241 WP_000060512.1.10055 WP_000060512.1.100649 WP_000060512.1.100684 WP_000060512.1.10069 WP_000060512.1.100771 WP_000060512.1.100912 WP_000060512.1.101224 WP_000060512.1.101309 WP_000060512.1.10584 WP_000060512.1.10688 WP_000060512.1.10745 WP_000060512.1.10762 WP_000060512.1.10845 WP_000060512.1.1112 WP_000060512.1.11324 WP_000060512.1.11380 WP_000060512.1.11442 WP_000060512.1.11521 WP_000060512.1.11584 WP_000060512.1.12751 WP_000060512.1.13024 WP_000060512.1.13113 WP_000060512.1.13279 WP_000060512.1.13299 WP_000060512.1.13424 WP_000060512.1.1354 WP_000060512.1.13975 WP_000060512.1.14006 WP_000060512.1.14039 WP_000060512.1.14084 WP_000060512.1.14174 WP_000060512.1.14176 WP_000060512.1.15502 WP_000060512.1.17374 WP_000060512.1.17408 WP_000060512.1.17797 WP_000060512.1.17940 WP_000060512.1.18749 WP_000060512.1.18840 WP_000060512.1.19438 WP_000060512.1.195 WP_000060512.1.19516 WP_000060512.1.20208 WP_000060512.1.20651 WP_000060512.1.20687 WP_000060512.1.20973 WP_000060512.1.21055 WP_000060512.1.21695 WP_000060512.1.2206 WP_000060512.1.22152 WP_000060512.1.226 WP_000060512.1.22699 WP_000060512.1.23181 WP_000060512.1.23297 WP_000060512.1.23307 WP_000060512.1.23360 WP_000060512.1.23427 WP_000060512.1.23652 WP_000060512.1.2407 WP_000060512.1.24182 WP_000060512.1.24184 WP_000060512.1.24377 WP_000060512.1.24680 WP_000060512.1.24792 WP_000060512.1.24795 WP_000060512.1.24969 WP_000060512.1.24992 WP_000060512.1.25290 WP_000060512.1.25505 WP_000060512.1.25599 WP_000060512.1.26483 WP_000060512.1.26499 WP_000060512.1.26637 WP_000060512.1.26872 WP_000060512.1.26965 WP_000060512.1.27106 WP_000060512.1.27140 WP_000060512.1.27334 WP_000060512.1.27732 WP_000060512.1.27931 WP_000060512.1.28237 WP_000060512.1.28913 WP_000060512.1.2904 WP_000060512.1.29209 WP_000060512.1.29836 WP_000060512.1.29993 WP_000060512.1.30061 WP_000060512.1.30091 WP_000060512.1.30144 WP_000060512.1.3026 WP_000060512.1.30788 WP_000060512.1.31050 WP_000060512.1.31221 WP_000060512.1.31503 WP_000060512.1.31685 WP_000060512.1.3180 WP_000060512.1.3196 WP_000060512.1.3249 WP_000060512.1.32522 WP_000060512.1.32784 WP_000060512.1.32927 WP_000060512.1.33045 WP_000060512.1.33061 WP_000060512.1.3318 WP_000060512.1.33201 WP_000060512.1.33717 WP_000060512.1.33790 WP_000060512.1.34061 WP_000060512.1.34125 WP_000060512.1.34175 WP_000060512.1.34587 WP_000060512.1.35026 WP_000060512.1.35095 WP_000060512.1.35694 WP_000060512.1.3612 WP_000060512.1.3615 WP_000060512.1.36226 WP_000060512.1.37027 WP_000060512.1.37093 WP_000060512.1.37239 WP_000060512.1.37635 WP_000060512.1.37661 WP_000060512.1.37801 WP_000060512.1.3798 WP_000060512.1.37990 WP_000060512.1.38345 WP_000060512.1.38427 WP_000060512.1.38517 WP_000060512.1.38591 WP_000060512.1.38645 WP_000060512.1.3925 WP_000060512.1.39255 WP_000060512.1.39317 WP_000060512.1.39411 WP_000060512.1.39896 WP_000060512.1.39957 WP_000060512.1.4039 WP_000060512.1.40430 WP_000060512.1.40818 WP_000060512.1.41090 WP_000060512.1.41464 WP_000060512.1.41518 WP_000060512.1.41729 WP_000060512.1.4185 WP_000060512.1.41879 WP_000060512.1.42167 WP_000060512.1.42182 WP_000060512.1.42218 WP_000060512.1.42237 WP_000060512.1.42485 WP_000060512.1.42747 WP_000060512.1.42941 WP_000060512.1.43442 WP_000060512.1.4354 WP_000060512.1.43762 WP_000060512.1.43767 WP_000060512.1.43914 WP_000060512.1.44428 WP_000060512.1.44449 WP_000060512.1.44463 WP_000060512.1.44497 WP_000060512.1.4453 WP_000060512.1.44956 WP_000060512.1.4496 WP_000060512.1.45317 WP_000060512.1.45720 WP_000060512.1.45835 WP_000060512.1.46157 WP_000060512.1.46326 WP_000060512.1.46586 WP_000060512.1.46746 WP_000060512.1.46864 WP_000060512.1.47000 WP_000060512.1.47095 WP_000060512.1.47097 WP_000060512.1.474 WP_000060512.1.47437 WP_000060512.1.47674 WP_000060512.1.47936 WP_000060512.1.47957 WP_000060512.1.47975 WP_000060512.1.48164 WP_000060512.1.48311 WP_000060512.1.48599 WP_000060512.1.49428 WP_000060512.1.49455 WP_000060512.1.4964 WP_000060512.1.49702 WP_000060512.1.499 WP_000060512.1.5025 WP_000060512.1.50316 WP_000060512.1.50514 WP_000060512.1.50694 WP_000060512.1.51047 WP_000060512.1.51072 WP_000060512.1.51087 WP_000060512.1.51335 WP_000060512.1.51556 WP_000060512.1.51681 WP_000060512.1.52532 WP_000060512.1.52756 WP_000060512.1.53621 WP_000060512.1.54007 WP_000060512.1.54142 WP_000060512.1.54240 WP_000060512.1.54419 WP_000060512.1.54547 WP_000060512.1.54775 WP_000060512.1.54777 WP_000060512.1.54782 WP_000060512.1.55057 WP_000060512.1.55077 WP_000060512.1.55116 WP_000060512.1.5543 WP_000060512.1.55788 WP_000060512.1.55893 WP_000060512.1.56055 WP_000060512.1.56320 WP_000060512.1.57105 WP_000060512.1.57203 WP_000060512.1.57561 WP_000060512.1.57732 WP_000060512.1.57815 WP_000060512.1.57859 WP_000060512.1.5841 WP_000060512.1.58586 WP_000060512.1.58632 WP_000060512.1.58814 WP_000060512.1.58822 WP_000060512.1.5895 WP_000060512.1.59016 WP_000060512.1.59052 WP_000060512.1.59058 WP_000060512.1.59773 WP_000060512.1.59997 WP_000060512.1.60012 WP_000060512.1.60153 WP_000060512.1.60236 WP_000060512.1.60255 WP_000060512.1.60274 WP_000060512.1.60334 WP_000060512.1.60781 WP_000060512.1.60841 WP_000060512.1.61126 WP_000060512.1.61243 WP_000060512.1.61944 WP_000060512.1.62277 WP_000060512.1.62770 WP_000060512.1.6304 WP_000060512.1.6340 WP_000060512.1.63476 WP_000060512.1.63743 WP_000060512.1.63789 WP_000060512.1.63902 WP_000060512.1.6426 WP_000060512.1.64282 WP_000060512.1.64377 WP_000060512.1.64566 WP_000060512.1.64568 WP_000060512.1.64615 WP_000060512.1.6475 WP_000060512.1.64764 WP_000060512.1.64770 WP_000060512.1.65803 WP_000060512.1.66535 WP_000060512.1.66932 WP_000060512.1.66999 WP_000060512.1.67001 WP_000060512.1.674 WP_000060512.1.6743 WP_000060512.1.6753 WP_000060512.1.67873 WP_000060512.1.67912 WP_000060512.1.68007 WP_000060512.1.6816 WP_000060512.1.68346 WP_000060512.1.6846 WP_000060512.1.68562 WP_000060512.1.68668 WP_000060512.1.69347 WP_000060512.1.69501 WP_000060512.1.70108 WP_000060512.1.70181 WP_000060512.1.70209 WP_000060512.1.70645 WP_000060512.1.71114 WP_000060512.1.71142 WP_000060512.1.71242 WP_000060512.1.71441 WP_000060512.1.71652 WP_000060512.1.72484 WP_000060512.1.72514 WP_000060512.1.72752 WP_000060512.1.72867 WP_000060512.1.73396 WP_000060512.1.73457 WP_000060512.1.73594 WP_000060512.1.73790 WP_000060512.1.7398 WP_000060512.1.74302 WP_000060512.1.74372 WP_000060512.1.74651 WP_000060512.1.74832 WP_000060512.1.74857 WP_000060512.1.74863 WP_000060512.1.74901 WP_000060512.1.74976 WP_000060512.1.75292 WP_000060512.1.7534 WP_000060512.1.75358 WP_000060512.1.75374 WP_000060512.1.75866 WP_000060512.1.75891 WP_000060512.1.7593 WP_000060512.1.75942 WP_000060512.1.76086 WP_000060512.1.76155 WP_000060512.1.7628 WP_000060512.1.76342 WP_000060512.1.76804 WP_000060512.1.76817 WP_000060512.1.76883 WP_000060512.1.76902 WP_000060512.1.77386 WP_000060512.1.77402 WP_000060512.1.77567 WP_000060512.1.77576 WP_000060512.1.77690 WP_000060512.1.77902 WP_000060512.1.77968 WP_000060512.1.78264 WP_000060512.1.79549 WP_000060512.1.79658 WP_000060512.1.80126 WP_000060512.1.80622 WP_000060512.1.80649 WP_000060512.1.80964 WP_000060512.1.81000 WP_000060512.1.81088 WP_000060512.1.81570 WP_000060512.1.81773 WP_000060512.1.82533 WP_000060512.1.82832 WP_000060512.1.8290 WP_000060512.1.82986 WP_000060512.1.83206 WP_000060512.1.83694 WP_000060512.1.83977 WP_000060512.1.84323 WP_000060512.1.84337 WP_000060512.1.8450 WP_000060512.1.84541 WP_000060512.1.84614 WP_000060512.1.85012 WP_000060512.1.85187 WP_000060512.1.85348 WP_000060512.1.85592 WP_000060512.1.85667 WP_000060512.1.8577 WP_000060512.1.85928 WP_000060512.1.86041 WP_000060512.1.86374 WP_000060512.1.86619 WP_000060512.1.86637 WP_000060512.1.86789 WP_000060512.1.869 WP_000060512.1.87013 WP_000060512.1.87416 WP_000060512.1.8759 WP_000060512.1.87725 WP_000060512.1.87768 WP_000060512.1.87777 WP_000060512.1.87947 WP_000060512.1.87960 WP_000060512.1.88154 WP_000060512.1.88200 WP_000060512.1.88431 WP_000060512.1.89009 WP_000060512.1.8923 WP_000060512.1.89698 WP_000060512.1.89704 WP_000060512.1.89718 WP_000060512.1.90352 WP_000060512.1.90452 WP_000060512.1.90466 WP_000060512.1.90665 WP_000060512.1.91020 WP_000060512.1.91367 WP_000060512.1.91404 WP_000060512.1.91615 WP_000060512.1.92586 WP_000060512.1.93582 WP_000060512.1.93683 WP_000060512.1.93838 WP_000060512.1.93932 WP_000060512.1.94270 WP_000060512.1.94308 WP_000060512.1.94914 WP_000060512.1.9533 WP_000060512.1.95457 WP_000060512.1.95484 WP_000060512.1.95576 WP_000060512.1.9623 WP_000060512.1.96272 WP_000060512.1.96287 WP_000060512.1.96437 WP_000060512.1.9700 WP_000060512.1.97082 WP_000060512.1.97262 WP_000060512.1.97561 WP_000060512.1.97617 WP_000060512.1.97670 WP_000060512.1.97816 WP_000060512.1.97842 WP_000060512.1.98557 WP_000060512.1.98571 WP_000060512.1.9860 WP_000060512.1.98604 WP_000060512.1.99212 WP_000060512.1.99266 WP_000060512.1.99558 WP_000060512.1.99636 WP_000060512.1.99908 gi|558683494|ref|YP_008821623.1| gi|163942541|ref|YP_001647425.1| gi|384188889|ref|YP_005574785.1| 226900.BC4807 315730.BcerKBAB4_4643 361100.BCQ_4623 405532.BCB4264_A4933 405534.BCAH187_A4948 gi|452201296|ref|YP_007481377.1| gi|222098281|ref|YP_002532338.1| gi|375286818|ref|YP_005107257.1| gi|410677215|ref|YP_006929586.1| gi|30022876|ref|NP_834507.1| gi|218235536|ref|YP_002369618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]