SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163942600|ref|YP_001647484.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163942600|ref|YP_001647484.1|
Domain Number 1 Region: 7-128
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.32e-24
Family DNA-binding N-terminal domain of transcription activators 0.00076
Further Details:      
 
Weak hits

Sequence:  gi|163942600|ref|YP_001647484.1|
Domain Number - Region: 167-246
Classification Level Classification E-value
Superfamily Antibiotic binding domain of TipA-like multidrug resistance regulators 0.0536
Family Antibiotic binding domain of TipA-like multidrug resistance regulators 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163942600|ref|YP_001647484.1|
Sequence length 256
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MSKKEGYSIGEFSKRTGTSIRTLQYYDELGLLKPEKNISSGHRVYKDRDILALQKIVSLK
VLGYSLEEIRVMLNVKSLNISLKETLQNQRVAFEEKKKQLEVSIKAIERTMVYLEEDEEV
DSNILMSLINSIQKENEQRLWLEEYVPKEVADGLYNKPEEEDIALDKEFMRLAKEVKRLF
GRQIEDSEVQKLVDEHMKATLKYVGEETMYSLGKLENVEEQYNNMMPSPYTEEEEAWLNE
AMKYFMIQNGLYSPPK
Download sequence
Identical sequences A9VM83
WP_012261901.1.99908 gi|163942600|ref|YP_001647484.1| 315730.BcerKBAB4_4703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]